DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42637 and gcy-3

DIOPT Version :10

Sequence 1:NP_524165.2 Gene:CG42637 / 40153 FlyBaseID:FBgn0261360 Length:1525 Species:Drosophila melanogaster
Sequence 2:NP_496037.1 Gene:gcy-3 / 191641 WormBaseID:WBGene00001530 Length:1140 Species:Caenorhabditis elegans


Alignment Length:75 Identity:16/75 - (21%)
Similarity:32/75 - (42%) Gaps:12/75 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   189 FGSSESI---GSDPGSLVSVSSSK------LMFTPSRSGTLSPKPTERKCSKKIIVENVSAMEIF 244
            ||...|:   |....:..|:|.:|      :.:.....|.:|.:|...|...:   ::|:..|..
 Worm    33 FGEQTSLKIDGIQTNTCRSISEAKWVCRRSIRYKQMEPGEVSDEPLNAKTGGR---QHVTKGETK 94

  Fly   245 RDAKSVRLRS 254
            ::|:.|.|.:
 Worm    95 KEAEHVGLET 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42637NP_524165.2 PBP1_SAP_GC-like 26..445 CDD:380593 16/75 (21%)
PK_GC-A_B 543..827 CDD:270944
HNOBA <833..881 CDD:462234
CYCc 860..1052 CDD:214485
gcy-3NP_496037.1 PBP1_NPR_GC-like 36..452 CDD:380575 14/72 (19%)
Protein Kinases, catalytic domain 554..823 CDD:473864
HNOBA <838..882 CDD:462234
CYCc 861..1051 CDD:214485
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.