DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42637 and acy-4

DIOPT Version :9

Sequence 1:NP_001007096.1 Gene:CG42637 / 40153 FlyBaseID:FBgn0261360 Length:1525 Species:Drosophila melanogaster
Sequence 2:NP_504486.4 Gene:acy-4 / 178949 WormBaseID:WBGene00000071 Length:1013 Species:Caenorhabditis elegans


Alignment Length:446 Identity:115/446 - (25%)
Similarity:190/446 - (42%) Gaps:77/446 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   650 FIASLIHDLIKGMIYIHNSQLVYHGNLKSSNCVVTSRWMLQ----VTDFGLHELRQCAENESIGE 710
            |:..:...|...||:|....|:.|..|.|  .|:...::|.    |...|::|.:...:.|...:
 Worm   610 FVPQMFIVLTSVMIFILTRALIKHARLVS--LVIGVLFILLSIQIVILMGMYESKFTCDVEKCFK 672

  Fly   711 HQHYRNQLWRAPELLRNHIHGSQKGDVYAFAIIMYEIFSRKGPFGQINFEPKEIVDYVKKLPLKG 775
            :.:  ...:...|:.           ..|..:|:...|..|.....|.|....::...|.:.:. 
 Worm   673 NNY--TDFFEIFEIC-----------TLATCVILSVDFMTKLLMSMIYFSSFTVLITAKLIRIN- 723

  Fly   776 EDPFRPEVESIIE--AESCPDYVLACIRDCWAEDPEERPEFSVIRNRLKKMRGGKTKNIMDQMME 838
                  :.|:::.  |..|   ||:|:..........|.|.....:.:.|::.      :|:.::
 Worm   724 ------QYEALLSTYANFC---VLSCLTLLLVVFSTRRSELISRYDFIWKLQA------LDEQLQ 773

  Fly   839 MMEKYANNLEDIVTERTRLLCEEKMKTEDLLHRMLPQSVA----EKLTMGQGVEPVSYDLVTIYF 899
            |..|:..|                   ..:|..:||..||    |..|....:...|.|...|.|
 Worm   774 MKRKHEQN-------------------RSVLENILPSHVAKHFVEDATSVSKLYHESRDNACIMF 819

  Fly   900 SDIVGFTAMSAE----STPLQVVNFLNDLYTVFDRII-------RGYDVYKVETIGDAYMVVSGL 953
            :.:..|.....|    :..::.:..||::.:.||:|:       ....:.|::||...|||.|||
 Worm   820 ATLTEFDKFYIECDGNNEGVECLRLLNEIISDFDQILDQILDREEFKKIEKIKTISTTYMVASGL 884

  Fly   954 PIKN-GDR-HAGEIASMALELLHAVKQHRIAHRPNETLKLRIGMHTGPVVAGVVGLTMPRYCLFG 1016
            ..:. ||. |...||..|.|||..::...| |..| ...||||::.|||||||:|...|.|.::|
 Worm   885 AGRECGDNSHVEAIALFARELLVKLESTNI-HSFN-NFNLRIGINVGPVVAGVIGSDKPHYDIWG 947

  Fly  1017 DTVNTASRMESNGEALKIHISNKCKLALDKLGGGYITEKRGLVNMKGKGDVVTWWL 1072
            ::||.||||:|.|.|.:|.::.:.|..|:.|  ||..|.||.:|:||||.:.|::|
 Worm   948 NSVNVASRMDSGGVAGRIQVTEEVKSILEPL--GYNFECRGQINVKGKGMMETFFL 1001

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42637NP_001007096.1 PBP1_Speract_GC_like 26..445 CDD:107365
ANF_receptor 48..412 CDD:279440
PK_GC-A_B 543..827 CDD:270944 32/182 (18%)
HNOBA <835..881 CDD:285003 9/49 (18%)
CYCc 860..1052 CDD:214485 68/208 (33%)
Guanylate_cyc 887..1074 CDD:278633 72/199 (36%)
acy-4NP_504486.4 AC_N <50..291 CDD:292831
CYCc 260..451 CDD:214485
Guanylate_cyc 293..448 CDD:278633
CYCc 778..984 CDD:214485 70/228 (31%)
Guanylate_cyc 807..1003 CDD:278633 72/199 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.