DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42637 and gcy-35

DIOPT Version :9

Sequence 1:NP_001007096.1 Gene:CG42637 / 40153 FlyBaseID:FBgn0261360 Length:1525 Species:Drosophila melanogaster
Sequence 2:NP_001252131.1 Gene:gcy-35 / 173202 WormBaseID:WBGene00001555 Length:688 Species:Caenorhabditis elegans


Alignment Length:694 Identity:184/694 - (26%)
Similarity:286/694 - (41%) Gaps:214/694 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   585 FPRKRDISREIMKE------MRLLRELRHDNINSFIGASVEPTRILLVTDYCAKGSLYDIIENED 643
            :|..:.:.||:.:.      :..::|.:.:::::|:...|    :.::|.          |||.:
 Worm   144 YPIVKGVVREVARRIYDTEVVMKVQERKQEHLDAFVTEHV----VFVITQ----------IENAN 194

  Fly   644 --------IKLDDLFIASLIHDLIKGMIYIHNSQ----LVYH------------GNLKSSNCVVT 684
                    .|.|...      ||..|:..|.:|.    ..||            ||.........
 Worm   195 STQPKSISSKADSQI------DLSTGIYEISSSDFSLAFPYHICFDPDLFVEHFGNFIKKTFPNA 253

  Fly   685 SRWMLQVTDFGLHELRQCAENESIGEHQHYRNQLWRAPELLRNHIHGSQKGDVYAFAIIMYEIFS 749
            .|...:|||  |.||.......|....::|:|.|:                           :|.
 Worm   254 MRQETRVTD--LLELVHPEVPFSYESIKYYKNSLF---------------------------VFR 289

  Fly   750 RKGPFGQI----NFEPKEIVDYVKKLPLKGEDPFRPE--------------VESIIEAESCPDYV 796
            .|| .|.|    |.|.|.::       |||...|..|              |..:||        
 Worm   290 LKG-LGDIVHNANDEAKTVL-------LKGSMVFIDEGKYILYMCSVNVTTVRELIE-------- 338

  Fly   797 LACIRDCWAEDPEE----RPEFSVIRNRLKKMRGGKTKNIMDQMMEMMEKYANNLEDIVTERTRL 857
                |:....|.:.    |....:.::|:.::...:|   :::..:.::|.|..||         
 Worm   339 ----RNLHLSDMQRHDGTRDVIMLNQSRMSQVELNRT---LEETTKKLKKMAQELE--------- 387

  Fly   858 LCEEKMKTEDLLHRMLPQSVAEKLTMGQGVEPVSYDLVTIYFSDIVGFTAMSAESTPLQVVNFLN 922
              .||.||::||..::|.|||:.|..|:.::...:...|:.|:|||.||.:.|..||..||..||
 Worm   388 --IEKQKTDELLCELMPASVADSLRSGKAMDAKEFADCTLLFTDIVTFTNICAMCTPYDVVTLLN 450

  Fly   923 DLYTVFDRIIRGYDVYKVETIGDAYMVVSGLPIKNGDRHAGEIASMALELLHAVK--QHRIAHRP 985
            |||..|||::..:|.|||||||||||:|.|:| :..:.||..:.::::.:|...|  ...|.|:|
 Worm   451 DLYLRFDRLVGLHDAYKVETIGDAYMIVGGVP-ERCENHAERVLNISIGMLMESKLVLSPITHKP 514

  Fly   986 NETLKLRIGMHTGPVVAGVVGLTMPRYCLFGDTVNTASRMESNGEALKIHISNKCKLALDKLGGG 1050
               :|:|:|:|.|||||||||:.||||||||||||.|::|||||...|||:|...||...|....
 Worm   515 ---IKIRLGVHCGPVVAGVVGIKMPRYCLFGDTVNVANKMESNGIQCKIHVSETGKLNGLKANPS 576

  Fly  1051 YITEKRGLVNMKGKGDVVTWWLTGANENAIQKKLVDMMDMPPPLFSRPRKSPKLNPDSRQPSIQA 1115
            |:...||...::|||.:.|::|...:..::.:           |.||||..              
 Worm   577 YVFIDRGNTEIRGKGMMYTYFLERNDRKSVWE-----------LCSRPRSG-------------- 616

  Fly  1116 MHFCGTGSRRQSTVPRAMD--GESTYSLQGSVRESPRMVSKRDRDRERPPINGLGAGHFVGGALL 1178
                      :.|:...|:  .:|.|..:|..:|:..:.            ||            
 Worm   617 ----------EQTIDGYMELHDQSIYQEEGGQQENLTVE------------NG------------ 647

  Fly  1179 ESAQASLSTLNHSETNETNCDMDGGSGGVSGS----GSGLVRQP 1218
            .|||.     ||:..|.|:   ..|...::||    ||..:|.|
 Worm   648 NSAQN-----NHNNNNNTH---HSGRKLMNGSSVDPGSHHIRSP 683

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42637NP_001007096.1 PBP1_Speract_GC_like 26..445 CDD:107365
ANF_receptor 48..412 CDD:279440
PK_GC-A_B 543..827 CDD:270944 52/293 (18%)
HNOBA <835..881 CDD:285003 14/45 (31%)
CYCc 860..1052 CDD:214485 92/193 (48%)
Guanylate_cyc 887..1074 CDD:278633 88/188 (47%)
gcy-35NP_001252131.1 HNOB 3..167 CDD:285002 3/22 (14%)
HNOBA 218..409 CDD:285003 52/253 (21%)
CYCc 388..579 CDD:214485 93/194 (48%)
Guanylate_cyc 415..599 CDD:278633 87/187 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.