DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42637 and gucy1b1

DIOPT Version :9

Sequence 1:NP_001007096.1 Gene:CG42637 / 40153 FlyBaseID:FBgn0261360 Length:1525 Species:Drosophila melanogaster
Sequence 2:XP_004911214.1 Gene:gucy1b1 / 100379900 XenbaseID:XB-GENE-950986 Length:618 Species:Xenopus tropicalis


Alignment Length:658 Identity:175/658 - (26%)
Similarity:279/658 - (42%) Gaps:183/658 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   516 KWKIELEIEG-LLWKIDPNEIKGYSGNEIVSSPSKVSLMSA----QSYGSRWTNQFVTSTG---- 571
            |.:.:|:.|| .|.:|..::.|.|   ::||:.:||..::|    |.:|:.:. .|...:|    
 Frog    26 KKEAQLDEEGQFLVRIIYDDSKTY---DLVSAATKVLNLNAGDILQMFGNMFF-VFCQESGYDTI 86

  Fly   572 -RLRGAVVRIKELKFPRKRDISREIMKEMRLLRELRHDNIN---------SFIGASVEPTRILLV 626
             |:.|:.|              ||.::.:..|    ||::.         ||.....|..:.|::
 Frog    87 LRVLGSNV--------------REFLQNLDAL----HDHLGTIYPGMRAPSFRCTDAEKGKGLIL 133

  Fly   627 TDYCAKGSLYDIIENEDIKLDDLFIASLIHDLIKGMIYIHNSQLVYHGNLKSSNCVVTSRWMLQV 691
            ..|..:..|.||:.. .:|.    :|..||.....|..|..         ::..|..| :::::.
 Frog   134 HYYSEREGLQDIVIG-IVKT----VAQQIHGTEIDMKVIQQ---------RNEECDHT-QFLIEE 183

  Fly   692 TDF---------------GLHELR-----------------------QCAENESIGEHQHYRNQL 718
            .|.               |..|.|                       ||.            |.:
 Frog   184 KDTREEDFYEDQDRFEENGTQESRISPYTFCKAFPFHIMFDRDLFVTQCG------------NAI 236

  Fly   719 WRA-PE-------------LLRNHIHGSQKGDVYAFAIIMY--EIFSRKGPFGQINFEPKEIVD- 766
            :|. |:             |:|.||      |:....|:.:  .:|..:...|.::.|..|..| 
 Frog   237 YRVLPQLQPGNCNLLSVFSLVRPHI------DISFHGILSHINTVFVLRSKEGLLDVEKSESEDE 295

  Fly   767 ----YVKKLPLKGEDPFRPEVESIIEAESCPDYVLACIRDCWAEDPEERPEFSVIRNRLKKMRG- 826
                .:..|.|||:..:.||.::|:         ..|.......|...|             || 
 Frog   296 LTGTEISCLRLKGQMIYLPEADNIL---------FLCSPSVMNLDDLTR-------------RGL 338

  Fly   827 --------GKTKNIMDQMMEMMEKYANNLE-DIVTER----TRLLCEEKMKTEDLLHRMLPQSVA 878
                    ..|::::....:..|:|....| :|:|:|    .|.|.:||.||:.||:.:||.|||
 Frog   339 YLSDIPLHDATRDLVLLGEQFREEYKLTQELEILTDRLQHTLRALEDEKKKTDTLLYSVLPPSVA 403

  Fly   879 EKLTMGQGVEPVSYDLVTIYFSDIVGFTAMSAEST----PLQVVNFLNDLYTVFDRIIRGYD--- 936
            .:|...:.|....||.|||.||.||||....::..    .:::||.|||:||.||.:....:   
 Frog   404 NELRHKRPVPAKRYDNVTILFSGIVGFNTFCSKHASGEGAMKIVNLLNDIYTRFDILTDSRNNPY 468

  Fly   937 VYKVETIGDAYMVVSGLPIKNGDRHAGEIASMALELLHAVKQHRIAHRPNETLKLRIGMHTGPVV 1001
            ||||||:||.||.|||:| :....||..|..:||:::....|.::   ..|::::.||:|||.||
 Frog   469 VYKVETVGDKYMTVSGIP-EPCVHHARSICHLALDMMEIAGQVQV---DGESVQITIGIHTGEVV 529

  Fly  1002 AGVVGLTMPRYCLFGDTVNTASRMESNGEALKIHISN---KCKLALDKLGGGYITEKRGLVNMKG 1063
            .||:|..||||||||:|||..||.|:.||..||::|.   :|.::.:.....:..:.||.|:|||
 Frog   530 TGVIGQRMPRYCLFGNTVNLTSRTETTGEKGKINVSEYTYRCLMSPENSDPQFHLQYRGPVSMKG 594

  Fly  1064 KGDVVTWW 1071
            |.|.:..|
 Frog   595 KTDPMQVW 602

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42637NP_001007096.1 PBP1_Speract_GC_like 26..445 CDD:107365
ANF_receptor 48..412 CDD:279440
PK_GC-A_B 543..827 CDD:270944 65/369 (18%)
HNOBA <835..881 CDD:285003 19/50 (38%)
CYCc 860..1052 CDD:214485 84/201 (42%)
Guanylate_cyc 887..1074 CDD:278633 81/195 (42%)
gucy1b1XP_004911214.1 HNOB 2..166 CDD:377902 38/166 (23%)
HNOBA 207..406 CDD:369471 49/238 (21%)
Guanylate_cyc 412..605 CDD:306677 81/195 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.