DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42637 and gucy1a2

DIOPT Version :9

Sequence 1:NP_001007096.1 Gene:CG42637 / 40153 FlyBaseID:FBgn0261360 Length:1525 Species:Drosophila melanogaster
Sequence 2:XP_009290254.2 Gene:gucy1a2 / 100330875 ZFINID:ZDB-GENE-121023-3 Length:608 Species:Danio rerio


Alignment Length:289 Identity:108/289 - (37%)
Similarity:152/289 - (52%) Gaps:51/289 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   769 KKLPLKGEDPFRPEVESIIEAESCPDYVLACIRDCWAEDPEERPEFSVIRNRLKKMRG------- 826
            |.:.|||:....||..||:...|                    |..    :||:::.|       
Zfish   277 KVMELKGQMLHLPESNSIMFLGS--------------------PRV----DRLEELMGRGLHLSD 317

  Fly   827 -------------GKTKNIMDQMMEMMEKYANNLEDIVTERTRLLCEEKMKTEDLLHRMLPQSVA 878
                         |:.....|.:.:.|:|....||    :..:.|.|||.:|.|||:.:.|..||
Zfish   318 IPIHDATRDVILVGEQAKAQDGLKKRMDKLKATLE----KTHQALEEEKRRTVDLLYSIFPGDVA 378

  Fly   879 EKLTMGQGVEPVSYDLVTIYFSDIVGFTAMSAESTPLQVVNFLNDLYTVFDRIIRGYDVYKVETI 943
            ::|..|..|:...:|.||:.|||||||||:.|:.||:||::.||:|||.||......||||:|||
Zfish   379 QRLWQGLPVQAKKFDDVTMLFSDIVGFTAVCAQCTPMQVISMLNELYTRFDYQCGILDVYKIETI 443

  Fly   944 GDAYMVVSGLPIKNGDRHAGEIASMALELLHAVKQHRIAHRPNETLKLRIGMHTGPVVAGVVGLT 1008
            ||||.|..||..|. |.||..||.|||:::...::  :.....:.:|||||:|:|.|:|||||:.
Zfish   444 GDAYCVAGGLHRKI-DSHAKPIALMALKMMELSEE--VLTPDGKPIKLRIGIHSGSVLAGVVGVM 505

  Fly  1009 MPRYCLFGDTVNTASRMESNGEALKIHIS 1037
            ||||||||:.|..||:.||......|::|
Zfish   506 MPRYCLFGNNVTLASKFESGSHPRCINVS 534

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42637NP_001007096.1 PBP1_Speract_GC_like 26..445 CDD:107365
ANF_receptor 48..412 CDD:279440
PK_GC-A_B 543..827 CDD:270944 13/77 (17%)
HNOBA <835..881 CDD:285003 15/45 (33%)
CYCc 860..1052 CDD:214485 88/178 (49%)
Guanylate_cyc 887..1074 CDD:278633 76/151 (50%)
gucy1a2XP_009290254.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.