DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LOX and Loxl2

DIOPT Version :9

Sequence 1:NP_002308.2 Gene:LOX / 4015 HGNCID:6664 Length:417 Species:Homo sapiens
Sequence 2:NP_523806.2 Gene:Loxl2 / 37485 FlyBaseID:FBgn0034660 Length:511 Species:Drosophila melanogaster


Alignment Length:210 Identity:86/210 - (40%)
Similarity:129/210 - (61%) Gaps:6/210 - (2%)


- Green bases have known domain annotations that are detailed below.


Human   210 YGLPDLVADPYYIQASTYVQKMSMYNLRCAAEENCLASTAYRADVRD----YDHRVLLRFPQRVK 270
            |..||||.|...|:.:.:::...|..::||.||||:|:.||:....|    |..|.||:|.....
  Fly   300 YIAPDLVVDYLEIEQTAHLEDRPMLLMQCAMEENCVANEAYQIQRDDPHWRYRSRRLLKFTAAAI 364

Human   271 NQGTSDFLPSRPRYSWEWHSCHQHYHSMDEFSHYDLLDANTQRRVAEGHKASFCLEDTSCDYGYH 335
            |.|.:||.|.:.:..||||.||.|:|||:.|:.:|:.:.. ..:||:||||||||||::|..|..
  Fly   365 NAGNADFRPFKEKSQWEWHMCHMHFHSMEVFATFDIFNLR-GIKVAQGHKASFCLEDSNCLPGVA 428

Human   336 RRFACTAH-TQGLSPGCYDTYGADIDCQWIDITDVKPGNYILKVSVNPSYLVPESDYTNNVVRCD 399
            :::.|..: .||:|..|.|.|..::||||:|:||:.||.|:||:::||.:.|.|.:|.||...||
  Fly   429 KKYNCANYGDQGISINCSDVYLYNLDCQWVDVTDLIPGTYVLKIAINPEFKVAEMNYDNNAAICD 493

Human   400 IRYTGHHAYASGCTI 414
            :.||.:.|....|.:
  Fly   494 LIYTANFARVQNCQL 508

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LOXNP_002308.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 64..89
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 137..174
Lysyl-oxidase like 213..417 85/207 (41%)
Lysyl_oxidase 213..414 CDD:366506 85/205 (41%)
Loxl2NP_523806.2 SR 61..161 CDD:214555
SRCR 66..160 CDD:278931
SR 193..298 CDD:214555
SRCR 198..298 CDD:278931
Lysyl_oxidase 303..503 CDD:279521 84/200 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D376277at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45817
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.