| Sequence 1: | NP_523720.2 | Gene: | Gbeta76C / 40148 | FlyBaseID: | FBgn0004623 | Length: | 346 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_500086.1 | Gene: | npp-20 / 176957 | WormBaseID: | WBGene00003806 | Length: | 313 | Species: | Caenorhabditis elegans |
| Alignment Length: | 268 | Identity: | 48/268 - (17%) |
|---|---|---|---|
| Similarity: | 100/268 - (37%) | Gaps: | 46/268 - (17%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 113 GNFVACGGMDNQCTVYDVNNRDASGVAKMVKELMGYEGFLSSCRFLD---DGHLITGSGDMKICH 174
Fly 175 WDLEKG--VKTMDFNGHAGDIAGLSLSPDMKTYITGSVDKTAKLWDVREEGHKQMFFG------H 231
Fly 232 DMDVSSVCYHPSGFG------FASCSEDQTARMYDLRADQQIAQYEPPQKNTGFTS-------CA 283
Fly 284 LSTSGRY-LMCGGIEGNV----------HSWDTMKQRHTGTLSGHENRITCISLCPNGMCLASTS 337
Fly 338 WDQQVRLW 345 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Gbeta76C | NP_523720.2 | WD40 | <45..345 | CDD:225201 | 47/266 (18%) |
| WD40 | 51..345 | CDD:238121 | 47/266 (18%) | ||
| WD40 repeat | 64..99 | CDD:293791 | |||
| WD40 repeat | 105..147 | CDD:293791 | 8/33 (24%) | ||
| WD40 repeat | 152..187 | CDD:293791 | 8/39 (21%) | ||
| WD40 repeat | 194..229 | CDD:293791 | 3/34 (9%) | ||
| WD40 repeat | 235..271 | CDD:293791 | 8/41 (20%) | ||
| WD40 repeat | 279..315 | CDD:293791 | 10/53 (19%) | ||
| WD40 repeat | 321..345 | CDD:293791 | 5/23 (22%) | ||
| npp-20 | NP_500086.1 | WD40 | 4..>285 | CDD:225201 | 48/268 (18%) |
| WD40 | 12..282 | CDD:295369 | 48/268 (18%) | ||
| WD40 repeat | 61..102 | CDD:293791 | 8/40 (20%) | ||
| WD40 repeat | 108..150 | CDD:293791 | 3/41 (7%) | ||
| WD40 repeat | 155..201 | CDD:293791 | 8/47 (17%) | ||
| WD40 repeat | 212..250 | CDD:293791 | 8/38 (21%) | ||
| WD40 repeat | 257..288 | CDD:293791 | 6/30 (20%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 0 | 0.000 | |||||