DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8765 and CG42526

DIOPT Version :9

Sequence 1:NP_649141.1 Gene:CG8765 / 40147 FlyBaseID:FBgn0036900 Length:690 Species:Drosophila melanogaster
Sequence 2:NP_001163401.1 Gene:CG42526 / 8674075 FlyBaseID:FBgn0260431 Length:245 Species:Drosophila melanogaster


Alignment Length:246 Identity:53/246 - (21%)
Similarity:103/246 - (41%) Gaps:53/246 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   315 FEKELITLIQQEDMIYNYGNENYRNAKLKMEVWEEIARKLKKSVKQCRLKWKALRDQYARE-HKR 378
            |:..||..:::...|:    |.|.....:.:.|..:|:..:|||:.|:::||:|||:|.|| .|.
  Fly     4 FDALLIASVKRNVSIF----EKYHTRYDRKQAWIAVAQACQKSVEYCQIRWKSLRDRYVRETQKP 64

  Fly   379 LRTLMHIDATSRWKHYNSLSFLQKYIQQK--------------------TLESDSQLSMLLPKND 423
            ..|..:|      :.:..|.||:::|:.:                    |::|.|...:.|.:|.
  Fly    65 AATRSNI------RKFKELDFLREHIRIRRKPNELCNTLNTNKTLVPGVTVDSQSADELALERNG 123

  Fly   424 PVRELEDHM------TQSHSPPTQQITLESSSSNSQLNLPT-LPHLTGPHKAEQQQQQQQQE--- 478
            ......|..      .:.:...|...:.|..|.:|..|:.: ||::|.|....:.|.|.|.:   
  Fly   124 ITEFQPDEFIIEYKGEEEYLSETDNSSAEFISEDSACNIGSELPYVTKPSFNGEGQSQTQAKFMS 188

  Fly   479 -----EQHQQQQQHQQQQQQQQASELCVATYDD---MDIE----NYINGDV 517
                 |...:.:..:.|....:..|..:...||   :||:    |:::.::
  Fly   189 VMNLIESALKDKPAEPQDPFYKYLESILTGVDDSTRIDIQLKVLNFVSDEI 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8765NP_649141.1 MADF 42..123 CDD:214738
MADF 318..405 CDD:214738 25/87 (29%)
CG42526NP_001163401.1 MADF 8..85 CDD:214738 25/86 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1634040at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.