DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8765 and zgc:152938

DIOPT Version :9

Sequence 1:NP_649141.1 Gene:CG8765 / 40147 FlyBaseID:FBgn0036900 Length:690 Species:Drosophila melanogaster
Sequence 2:NP_001070756.1 Gene:zgc:152938 / 768145 ZFINID:ZDB-GENE-061013-458 Length:292 Species:Danio rerio


Alignment Length:190 Identity:49/190 - (25%)
Similarity:88/190 - (46%) Gaps:34/190 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 LISLVSQEQSLYNPKHPHYRSTKIKDEKWLEIGSNVGWSDVQCKSKWKAMRDQYCRELKRAKACS 106
            ||||||..:.|::..|..|:....::..|.||...:|:.....|:|||.:||.|.|: ||...|:
Zfish    60 LISLVSDRRELFDQNHIDYKHIDKREALWQEIAEKIGFHVDDVKTKWKNLRDTYIRK-KREDQCT 123

  Fly   107 ------KAVKWKYFKELDFLRPYALARNYRGRSGQTSNGAVGTVTPLSLPMTTSFSSNSSSQNLN 165
                  |...||:.|.::||...:..|.... |.:.|...||             ..:.|.::| 
Zfish   124 GEQTPKKKKTWKFMKMMEFLATSSEQRRVHS-SVKESADEVG-------------DGSESEKSL- 173

  Fly   166 LSGSIKIEDASASTLLDSCSFSSPSSTDKKPAAT--FLASHIGA-VLQQQQQQQQHQQQM 222
               ||.:|.|.:|..:.:      :|..:|.:.|  |:..::.| .::.:::::..:|:|
Zfish   174 ---SISVESAVSSEPVQA------NSKKRKRSVTPDFVEKYLAAKEVRDREREECRKQRM 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8765NP_649141.1 MADF 42..123 CDD:214738 30/86 (35%)
MADF 318..405 CDD:214738
zgc:152938NP_001070756.1 MADF_DNA_bdg 60..128 CDD:287510 24/68 (35%)
BESS 226..260 CDD:281011
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1634040at2759
OrthoFinder 1 1.000 - - FOG0001895
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.