DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8765 and si:ch211-207i20.3

DIOPT Version :9

Sequence 1:NP_649141.1 Gene:CG8765 / 40147 FlyBaseID:FBgn0036900 Length:690 Species:Drosophila melanogaster
Sequence 2:XP_683419.5 Gene:si:ch211-207i20.3 / 555734 ZFINID:ZDB-GENE-141222-71 Length:263 Species:Danio rerio


Alignment Length:220 Identity:57/220 - (25%)
Similarity:92/220 - (41%) Gaps:53/220 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 PQQQHVNLSIDPSLGENVVSIPKELILISLVSQEQSLYNPKHPHYRSTKIKDEKWLEIGSNVGWS 80
            |..:..:.|:..|:   ||.:..||:|. |||:.:.|::..|..|::||.|:..|..|...:|..
Zfish    13 PIHKPTHYSVRRSM---VVKMDAELLLF-LVSENKELFDKNHSEYKNTKRKEALWQGIADKMGVD 73

  Fly    81 DVQCKSKWKAMRDQYCRELKR--------AKACSKAVKWKYFKELDFLRPYALARNYRGRSG--- 134
            ..:.|:|||.:||.|.|: ||        .:|..|..:|||.:.:|||.|..     ..|||   
Zfish    74 VEEVKAKWKNLRDTYTRK-KRLEQDGSRSGRAAKKKKQWKYMRVMDFLDPAT-----EHRSGILD 132

  Fly   135 --------QTSNGAVGTVTPLSLPMTTSFSSNSSSQNLNLSGSIKIEDASASTLLDSCSFSSPSS 191
                    ...:||.        |.:||..::.:|.....|..:|...:....||:.        
Zfish   133 SKIEDDEPDEDSGAE--------PASTSTGTSVTSPEAMRSSIVKRRRSETLELLEK-------- 181

  Fly   192 TDKKPAATFLASHIGAVLQQQQQQQ 216
                    :||:......::.:|||
Zfish   182 --------YLATKDAKDREKDEQQQ 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8765NP_649141.1 MADF 42..123 CDD:214738 31/88 (35%)
MADF 318..405 CDD:214738
si:ch211-207i20.3XP_683419.5 MADF 35..122 CDD:214738 31/88 (35%)
BESS 199..233 CDD:308542 57/220 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1634040at2759
OrthoFinder 1 1.000 - - FOG0001895
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.