DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8765 and Adf1

DIOPT Version :9

Sequence 1:NP_649141.1 Gene:CG8765 / 40147 FlyBaseID:FBgn0036900 Length:690 Species:Drosophila melanogaster
Sequence 2:NP_001260730.1 Gene:Adf1 / 47082 FlyBaseID:FBgn0284249 Length:274 Species:Drosophila melanogaster


Alignment Length:366 Identity:74/366 - (20%)
Similarity:128/366 - (34%) Gaps:124/366 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 ELILISLVSQEQSLYNPKHPHYRSTKIKDEKWLEIGSNVGWSDVQCKSKWKAMRDQYCRELKRAK 103
            :|.||..|.....:|:..|.:|:....|.:.|.:|...:|..:.:|..:||::||::.||:   |
  Fly    13 DLNLIEAVKLNPVIYDRSHYNYKHFVRKAQTWKQIAETLGVPEQKCTKRWKSLRDKFAREM---K 74

  Fly   104 ACSKAVKWKYFKELDFLRPYALARNYRGRSGQTSNGAVGTVTPLSLPMTTSFSSNSSSQNLNLSG 168
            .|.:: :|:|||::.||  ....|.||                                      
  Fly    75 LCQES-RWRYFKQMQFL--VDSIRQYR-------------------------------------- 98

  Fly   169 SIKIEDASASTLLDSCSFSSPSSTDKKPAATFLASHIGAVLQQQQQQQQHQQQMHSQPEANWNYL 233
                     .:||..|:..|.|           |:.:....||||.|||....:.:||   :|  
  Fly    99 ---------ESLLGKCANGSQS-----------ANQVADPSQQQQAQQQTVVDIFAQP---FN-- 138

  Fly   234 TDAGGGATPSIIVQCGTANTTTVVDTLYNEIVDCVNAANQSSSAATITSNVSTTSAAHN------ 292
                           |:|.|:....|..:||              |:||:....:|...      
  Fly   139 ---------------GSATTSAQALTHPHEI--------------TVTSDAQLATAVGKDQKPYF 174

  Fly   293 -----QSTNAEEEDDDPIHTFLNMESYFEKELITLIQQEDMIYNYGNENYRN---AKLKMEVWEE 349
                 :...:|||..|   ..||....|:..:...:..||..:.....:..|   .:.|.|....
  Fly   175 YEPPLKRERSEEEHSD---NMLNTIKIFQNNVSQAVSAEDQSFGMVVTDMLNTLGVRQKAEAKVH 236

  Fly   350 IARKLKKSVKQCRLKWKALRDQYARE---HKRLRTLMHIDA 387
            |.:.|..      ::..|..::| ..   |::|..|:.:::
  Fly   237 IIKYLTD------MQLLAQHNKYXLSGGCHRQLLQLLQLES 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8765NP_649141.1 MADF 42..123 CDD:214738 25/80 (31%)
MADF 318..405 CDD:214738 12/76 (16%)
Adf1NP_001260730.1 MADF 15..95 CDD:214738 25/85 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1634040at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.