DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8765 and hng2

DIOPT Version :9

Sequence 1:NP_649141.1 Gene:CG8765 / 40147 FlyBaseID:FBgn0036900 Length:690 Species:Drosophila melanogaster
Sequence 2:NP_649837.1 Gene:hng2 / 41056 FlyBaseID:FBgn0037634 Length:254 Species:Drosophila melanogaster


Alignment Length:172 Identity:39/172 - (22%)
Similarity:66/172 - (38%) Gaps:40/172 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   314 YFEKELITLIQQEDMIYNYGNENYRNAKLKMEVWEEIARKL------------KKSVKQCRLKWK 366
            |...|.|..:.:..:|:...:.|:.|.:|:.|.|::|..:|            ::.||....:||
  Fly    16 YSMYEFIDAVHKRSIIWERSHPNFHNRELRDEAWQQIGHELCSNFDDSSEPEKQEIVKTLLKRWK 80

  Fly   367 ALRDQYAREHKRLRTLMHIDATSRWKHYNSLSFLQKYIQQKTLESDSQLSMLLPKNDPVRELEDH 431
            ..||.|.|.: |||......|.:.:.:...||||              |::.....|.|..|::.
  Fly    81 NTRDSYLRVN-RLRQSGEEVARASYIYEKELSFL--------------LNVKAESEDDVESLKEQ 130

  Fly   432 MTQSHSPPTQQITLESSSSNSQLNLPTLPHLTGPHKAEQQQQ 473
                   |..|...:..|:.:|.:..|      |.|....|:
  Fly   131 -------PKPQAKRKRVSTAAQRSAKT------PRKRNSDQE 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8765NP_649141.1 MADF 42..123 CDD:214738
MADF 318..405 CDD:214738 26/98 (27%)
hng2NP_649837.1 MADF_DNA_bdg 21..113 CDD:287510 23/92 (25%)
BESS 216..250 CDD:281011
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001895
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.