DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8765 and Mes2

DIOPT Version :9

Sequence 1:NP_649141.1 Gene:CG8765 / 40147 FlyBaseID:FBgn0036900 Length:690 Species:Drosophila melanogaster
Sequence 2:NP_730768.1 Gene:Mes2 / 40514 FlyBaseID:FBgn0037207 Length:437 Species:Drosophila melanogaster


Alignment Length:549 Identity:103/549 - (18%)
Similarity:187/549 - (34%) Gaps:174/549 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LPCANQLQEHQQPQQQHVNLSIDPSLGEN----VVSIPKELI-------------LISLVSQEQS 51
            ||.|....:........:.|.:.|.|..:    ..::|.:.|             ||.:|.....
  Fly     8 LPTATHSLQDMSAAAAAIALDMKPKLEPHPLAAATAMPSQKIKKLVRRNASDKLKLIQMVHDNPI 72

  Fly    52 LYNPKHPHYR-STKIKDEKWLEIGSNVGWSDVQCKSKWKAMRDQYCRELKRAKACSKAV--KWKY 113
            |::.:.|::: :.:.|:..|..||........:....:|::|:.|.|||...|......  ||..
  Fly    73 LWDSRLPNFKGAEEEKNRAWEHIGREFNAPGRRVARAFKSLRESYRRELAHVKLMGNGFKPKWSL 137

  Fly   114 FKELDFLRPYALARNYRGRSGQTSNGAVGTVTPLSLPMTTSFSSNSSSQNLNLSGSIKIEDASAS 178
            ::.:||||.  :.|..:|.|..|           .|.:||....|:::.|.|.|.|: .....|.
  Fly   138 YEAMDFLRD--VIRERKGASHAT-----------DLSLTTYGHINNNNNNNNNSNSL-AAGGKAM 188

  Fly   179 TLLDSCSFSSPSSTDKKPAATFLASHIGAVLQQQQQQQQHQQQMHSQPEANWNYLTDAGGGATPS 243
            ||..|.||:..:|          ..::............:....:.:||.:    ...||||..|
  Fly   189 TLKLSNSFNESAS----------VLNLSKCSSLNVSDDHYYCDYYVKPELD----LSVGGGAGSS 239

  Fly   244 IIVQCGTANTTTVVDTLYNEIVDCVNAANQSSSAATITSNVSTTSAAHNQSTNAEEEDDDPIHTF 308
                  |:.:::....|       ...|:|:.:.:.::|..:...|.|:   :.|:.||..|.: 
  Fly   240 ------TSGSSSGGGPL-------PLPAHQAHNDSRVSSTRNEQRAQHH---SYEDMDDSSIRS- 287

  Fly   309 LNMESYFEKELITLIQQEDMIYNYGNENYRNAKLKMEVWEEIARKLKKSVKQCRLKWKALRDQYA 373
                                    |:|:..:|.   :|.||                        
  Fly   288 ------------------------GDEDIAHAS---DVVEE------------------------ 301

  Fly   374 REHKRLRTLMHIDATSRWKHYNSLSFLQKYIQQKTLESDSQLSMLLPKNDPV--RELEDHMTQSH 436
                    |..|||          .|....|    |:|:|:.|..:..:|.|  |:|..::.|. 
  Fly   302 --------LDAIDA----------DFPYPLI----LDSNSRGSPNVGVDDVVMSRKLRRNVDQD- 343

  Fly   437 SPPTQQITLESSSSNSQLNLPTLPHLTGPHKAEQQQQQQQQEEQHQQQQQ----------HQQQQ 491
                   .||..:.:....:          ..:..::|..|:.:|.:|||          ..|..
  Fly   344 -------VLEEGNGHGDAVI----------DGDDYEEQMLQQHRHLRQQQGVASGGLDLPPPQTV 391

  Fly   492 QQQQASELC------VATYDDMDIENYIN 514
            ::...|:.|      :.:.:|.|.:|.:|
  Fly   392 REVLNSKFCGFISAKLNSMEDSDADNLMN 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8765NP_649141.1 MADF 42..123 CDD:214738 22/83 (27%)
MADF 318..405 CDD:214738 11/86 (13%)
Mes2NP_730768.1 MADF 62..149 CDD:214738 22/88 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.