DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8765 and CG6683

DIOPT Version :9

Sequence 1:NP_649141.1 Gene:CG8765 / 40147 FlyBaseID:FBgn0036900 Length:690 Species:Drosophila melanogaster
Sequence 2:NP_648232.1 Gene:CG6683 / 38970 FlyBaseID:FBgn0035902 Length:197 Species:Drosophila melanogaster


Alignment Length:149 Identity:36/149 - (24%)
Similarity:56/149 - (37%) Gaps:30/149 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   313 SYFEKELITLIQQEDMIYNYGNENYRNA------KLKMEVWEEIARKLKKSVKQCRLKWKALRDQ 371
            |.|:..||.|::....:|   ....|||      |...|:|..||..|......|..:|..|   
  Fly     2 SQFDTRLIELVRANPKLY---ERELRNAPYEAHKKRHPEIWSSIATSLNSEASACVSRWNHL--- 60

  Fly   372 YAREHKRLRTLMHIDATSRWKHYNSLSFLQKY-----------IQQKTLESDSQLSMLLPKNDPV 425
            .|::.:.|.........|.|.....|.|||.:           :.:.||:|..:::   ...||:
  Fly    61 VAKQRRELAKEKAGGTGSDWSLLPHLKFLQHHHHPINHRNSGDLSRSTLKSSDEVN---DDEDPL 122

  Fly   426 RELEDHMT----QSHSPPT 440
            :|..|...    .:.:|||
  Fly   123 QEAMDEQLAVAGAAPAPPT 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8765NP_649141.1 MADF 42..123 CDD:214738
MADF 318..405 CDD:214738 24/103 (23%)
CG6683NP_648232.1 MADF 7..94 CDD:214738 24/92 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.