DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8765 and LOC3291443

DIOPT Version :10

Sequence 1:NP_649141.1 Gene:CG8765 / 40147 FlyBaseID:FBgn0036900 Length:690 Species:Drosophila melanogaster
Sequence 2:XP_552389.2 Gene:LOC3291443 / 3291443 VectorBaseID:AGAMI1_009651 Length:302 Species:Anopheles gambiae


Alignment Length:79 Identity:23/79 - (29%)
Similarity:30/79 - (37%) Gaps:17/79 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 RDGDGLGSDNIDMNESLKSLKRKRSRRGG--------SDGNSGSKRRMNLEAVPEKSSSSWED-- 131
            |||:.:.::|.|..:.  ..:|...||||        ..|..|...|.|.|....|...|:||  
Mosquito    86 RDGERVSNENGDRPQG--ENRRGGPRRGGERGAARPAGRGGRGGFTRENREGEEPKQEVSFEDGQ 148

  Fly   132 -----LEVDGFVLG 140
                 ....||.||
Mosquito   149 DTRAPRRRGGFTLG 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8765NP_649141.1 MADF 42..123 CDD:214738 15/53 (28%)
MADF 318..405 CDD:214738
LOC3291443XP_552389.2 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.