DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8765 and CG15601

DIOPT Version :10

Sequence 1:NP_649141.1 Gene:CG8765 / 40147 FlyBaseID:FBgn0036900 Length:690 Species:Drosophila melanogaster
Sequence 2:NP_573058.1 Gene:CG15601 / 32509 FlyBaseID:FBgn0030673 Length:277 Species:Drosophila melanogaster


Alignment Length:86 Identity:23/86 - (26%)
Similarity:31/86 - (36%) Gaps:31/86 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   450 LASQSKACRGDNNSSVERFKF---ADERKCKRKQKMEVVDEPMTFLILDTSVDKGGHTSGIRRRR 511
            |:..|:...|.||:...||.|   .||.|          :||            .|:.:|    |
  Fly     5 LSKTSEEEPGGNNNITSRFTFKTSIDESK----------EEP------------SGNIAG----R 43

  Fly   512 HLPKEAFGESSQNQS--GTSK 530
            ..||..:..|...:|  .|||
  Fly    44 LPPKTPYKSSIAGKSPINTSK 64

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8765NP_649141.1 MADF 42..123 CDD:214738
MADF 318..405 CDD:214738
CG15601NP_573058.1 MADF_DNA_bdg 14..101 CDD:463144 21/77 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.