DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8765 and CG4404

DIOPT Version :9

Sequence 1:NP_649141.1 Gene:CG8765 / 40147 FlyBaseID:FBgn0036900 Length:690 Species:Drosophila melanogaster
Sequence 2:NP_572838.2 Gene:CG4404 / 32241 FlyBaseID:FBgn0030432 Length:308 Species:Drosophila melanogaster


Alignment Length:277 Identity:58/277 - (20%)
Similarity:103/277 - (37%) Gaps:73/277 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   302 DDPIHTFLNMESYFEKELITLIQQEDMIYNYGNENYRNAKLKMEVWEEIARKLKKSVKQCRLKWK 366
            |||:         |....:..::.:..::||.:..|...:.....|:::|..:|.:|:.||.:|:
  Fly    10 DDPV---------FNVRFVQFVENQPCLWNYTHPGYSKKEDVQRAWQQVANDIKDTVRNCRERWR 65

  Fly   367 ALRDQYAREHKRLRTLMHIDATSRWKH-YNSLSFLQKYIQ-----QKTLESDSQL-SMLL--PKN 422
            .:|..:.|..|..||     .|.|.|. |    :|.||:|     .|:.....|| .|:|  |..
  Fly    66 TIRSSFLRSLKLART-----QTGRGKRKY----YLSKYLQFLVPFTKSRSCHKQLPGMVLRKPGQ 121

  Fly   423 DPVRELEDHMTQSHSPPTQQITLESSSSNSQLNLPTLPHLTGPHKAEQQQQQQQQEEQ------- 480
            ....:.||.:..:..        |:..|:.::.|.     ....:.|.::.|:|..||       
  Fly   122 AATAQQEDEVVAAEE--------EAKVSDGEMPLD-----VQVSEEEHRRNQEQDREQPTACLPL 173

  Fly   481 --HQQQQQHQ----QQQQQQQASELCVATYDDMDIENYI-----------NGDVHHNDDDVEDDE 528
              |..:.:|.    .||.::..|:..:.:.....:.|::           :|..||.        
  Fly   174 RLHSIKVEHDSSNANQQLERMVSQQSLVSVPAAALGNHLGWSDLTQWFKGHGSGHHK-------- 230

  Fly   529 DEEMETTTAAEQPPQQQ 545
             ....|||....||..|
  Fly   231 -LTTTTTTPTSPPPPPQ 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8765NP_649141.1 MADF 42..123 CDD:214738
MADF 318..405 CDD:214738 22/87 (25%)
CG4404NP_572838.2 MADF 17..103 CDD:214738 23/94 (24%)
BESS 267..301 CDD:281011
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001895
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.