DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8765 and madf-9

DIOPT Version :9

Sequence 1:NP_649141.1 Gene:CG8765 / 40147 FlyBaseID:FBgn0036900 Length:690 Species:Drosophila melanogaster
Sequence 2:NP_500389.2 Gene:madf-9 / 191167 WormBaseID:WBGene00022608 Length:333 Species:Caenorhabditis elegans


Alignment Length:314 Identity:66/314 - (21%)
Similarity:117/314 - (37%) Gaps:77/314 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 QHVNLSIDPSLGENVVSIPK-ELILISLVSQEQSLYNPKHPHYRSTKIKDEKWLEIGSNVGWSDV 82
            :.:|..:..|....:...|. .:.||:.|.....||:.....|.....::..|.||..|:..:..
 Worm    29 KEINFLLASSKNMKIEETPVFNIRLIAEVKARPFLYDQSDEGYNLLSWRNSAWNEIAENLETTSE 93

  Fly    83 QCKSKWKAMRDQYCRELKRAKACSKAVKWKYFKELDFLRPYALARNYRGRSGQTSNGAV-----G 142
            ..|::||.:||:|.:|.|:.:...||..|.:.:.|.|::.:...|:........|..||     |
 Worm    94 HVKTRWKTLRDRYKKEEKKERVSKKASSWVFQRPLKFIQAHLKDRHTDETDSNQSEPAVKPEPNG 158

  Fly   143 TVTPLSLPMTTSFSSNS---SSQNLNLSGSI-KIEDASASTLLDSCSFSS--------------- 188
            .|:|:...|  ||..|.   :..:...|||. ::|.:||||...:.|..:               
 Worm   159 HVSPMEAAM--SFIENELIRTQDSSKSSGSTGEMESSSASTASSASSSKNTGTQEGGEASVITPP 221

  Fly   189 ----PSSTDKKPAATFLASHIGAVLQQQQQQQQHQQQMHSQPEANWNYLTDAGGGATPSIIVQCG 249
                |.:....|:||..||:.|..:::.:..                 :|:   |.||.      
 Worm   222 PLPIPMAVTPSPSATSSASNGGPAVKRSRVS-----------------ITE---GMTPV------ 260

  Fly   250 TANTTTVVDTLYNEIVDCVNAANQSSSAATITSNVSTTSAAHNQSTNAEEEDDD 303
                                |:..:::||..:..:|........:|..|||:|:
 Worm   261 --------------------ASRNAAAAAAASLGLSFFPGLSQWATTREEEEDE 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8765NP_649141.1 MADF 42..123 CDD:214738 23/80 (29%)
MADF 318..405 CDD:214738
madf-9NP_500389.2 MADF 52..136 CDD:214738 23/83 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CZ6Y
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.