DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8765 and madf-10

DIOPT Version :9

Sequence 1:NP_649141.1 Gene:CG8765 / 40147 FlyBaseID:FBgn0036900 Length:690 Species:Drosophila melanogaster
Sequence 2:NP_492729.1 Gene:madf-10 / 190925 WormBaseID:WBGene00013717 Length:234 Species:Caenorhabditis elegans


Alignment Length:135 Identity:29/135 - (21%)
Similarity:54/135 - (40%) Gaps:11/135 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   281 TSNVSTTSAAHNQSTNAEEEDDDPIHTFL-NMESYFEKELITLIQQEDMIYNYGNENYRNAKLK- 343
            :.:.||....|:..|:...:..:.:...: .:.......:...|.....:::...|...:|..| 
 Worm    14 SQSTSTGPTPHSHMTHVVPQQKEEVQYMMRQVTDSVRFAMCEAIAHRPGLWDSTREKVSSAARKN 78

  Fly   344 --MEVWEEIARKLKKS----VKQCRLKWKALRDQYAREHKRLRTLMHIDATSR--WKHYNSLSFL 400
              .||.|.|.::...|    :::....||.|:|.|.:..::| |..|.....|  ||.::||.||
 Worm    79 LFAEVVEVINQQFVLSPPLTIEEIEKHWKNLKDTYVKTRRKL-TFDHDGCPIRPKWKFFDSLMFL 142

  Fly   401 QKYIQ 405
            ....|
 Worm   143 DSVNQ 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8765NP_649141.1 MADF 42..123 CDD:214738
MADF 318..405 CDD:214738 24/95 (25%)
madf-10NP_492729.1 MADF 53..147 CDD:214738 24/94 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 44 1.000 Domainoid score I8335
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001895
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.