DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8765 and madf-3

DIOPT Version :9

Sequence 1:NP_649141.1 Gene:CG8765 / 40147 FlyBaseID:FBgn0036900 Length:690 Species:Drosophila melanogaster
Sequence 2:NP_494766.1 Gene:madf-3 / 186755 WormBaseID:WBGene00019218 Length:312 Species:Caenorhabditis elegans


Alignment Length:376 Identity:63/376 - (16%)
Similarity:116/376 - (30%) Gaps:172/376 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 LILISLVSQEQSLYNPKHPHYRSTKIKDEKWLEIGSNVGW-SDVQCKS-KWKAMRDQYCRELKRA 102
            |.||..|...:.|::.....||:|:.|:..|..:.:.:|: .|.:..| :||.:||:|.:|.::.
 Worm     8 LRLIEAVRHSRCLFDNTDRQYRNTEYKNRVWQRLVTVLGFDGDPRMLSARWKQLRDKYGKEKRKQ 72

  Fly   103 KACSKAVKWKYFKELDFLRPYALARNYRGRSGQTSNGAVGTVTPLSLPMTTSFSSNSSSQNLNLS 167
            |..::...|:|||.|.||.|                                             
 Worm    73 KYGNEKSSWQYFKHLHFLDP--------------------------------------------- 92

  Fly   168 GSIKIEDASASTLLDSCSFSSPSSTDKKPAATFLASHIGAVLQQQQQQQQHQQQMHSQPEANWNY 232
                                                                            :
 Worm    93 ----------------------------------------------------------------H 93

  Fly   233 LTDAGGGATPSIIVQCGTANTTTVVDTLYNEIVDCVNAANQSSSAATITSNVSTTSAAHNQSTNA 297
            :||..                         ||                       |.:..:.|..
 Worm    94 MTDRA-------------------------EI-----------------------SPSRKEPTGV 110

  Fly   298 EEEDDDPIHTFLNMESYFEKELITLIQQEDMIYNYGNENYRNAKLKMEVWEEIARKLK--KSVKQ 360
            .|:..:|.         |.|.||..:::...:|:..:..||:...:.:.|..|..||:  .:|..
 Worm   111 HEKIAEPC---------FGKNLILEVRRHPCLYDVRDPKYRHGDCRTQAWGMIIDKLRYPGTVPS 166

  Fly   361 CRLKWKALRDQYAREHKRLRTL--MHIDATSRWKHYNSLSFLQKYIQQKTL 409
            ...:||..||:|.||.:|||.|  .::...|.|:.|:.::::.:::.::.|
 Worm   167 IYKQWKKHRDRYVREKRRLRNLGDPNVQDVSTWEMYDDMAWIDQHLDEQQL 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8765NP_649141.1 MADF 42..123 CDD:214738 26/82 (32%)
MADF 318..405 CDD:214738 24/90 (27%)
madf-3NP_494766.1 MADF 9..94 CDD:214738 27/193 (14%)
MADF 122..212 CDD:214738 24/89 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CZ6Y
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 107 1.000 Inparanoid score I3497
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001895
OrthoInspector 1 1.000 - - otm14530
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.860

Return to query results.
Submit another query.