DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8765 and si:ch73-59f11.3

DIOPT Version :9

Sequence 1:NP_649141.1 Gene:CG8765 / 40147 FlyBaseID:FBgn0036900 Length:690 Species:Drosophila melanogaster
Sequence 2:NP_001315046.1 Gene:si:ch73-59f11.3 / 107988036 ZFINID:ZDB-GENE-131121-446 Length:180 Species:Danio rerio


Alignment Length:164 Identity:40/164 - (24%)
Similarity:71/164 - (43%) Gaps:28/164 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 HPHYRSTKIKDEK--------WLEIGSNVGWSDVQ-CKSKWKAMRDQYCRELKR--AKACSKAVK 110
            :||.....::|.|        |.||.:.:|..:.: |||.|:.:||::.:.:||  .|...:..:
Zfish    15 YPHLYDHSLRDFKVPEKVFNSWKEIATKLGIDNPETCKSTWRNIRDKFSKAMKRMLRKGGDEDAR 79

  Fly   111 W-KYFKELDFLRPYALARNYRGRSGQTSNGAV------GTVTPLSLPMTTSFSSNSSSQNLNLSG 168
            . :.|.||.:|||:.     |.|:...|:...      ...||.::....|.||:..:...::.|
Zfish    80 VPRLFVELKWLRPFV-----RLRANTVSDTPCFEFEIQNEETPKNMVAEESSSSSGCTNESDVEG 139

  Fly   169 -----SIKIEDASASTLLDSCSFSSPSSTDKKPA 197
                 |:.....||...|.|....:.:||..:|:
Zfish   140 RCSAASLDAFGTSALHRLSSTPCEAVTSTIAQPS 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8765NP_649141.1 MADF 42..123 CDD:214738 22/77 (29%)
MADF 318..405 CDD:214738
si:ch73-59f11.3NP_001315046.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1634040at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.