DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8765 and LOC100330838

DIOPT Version :9

Sequence 1:NP_649141.1 Gene:CG8765 / 40147 FlyBaseID:FBgn0036900 Length:690 Species:Drosophila melanogaster
Sequence 2:NP_001373242.1 Gene:LOC100330838 / 100330838 -ID:- Length:204 Species:Danio rerio


Alignment Length:122 Identity:35/122 - (28%)
Similarity:62/122 - (50%) Gaps:11/122 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   311 MESYFEKELITLIQQEDMIYNYGNENYRNAKLKMEVWEEIARKLKKSVKQCRLKWKALRDQYARE 375
            |.:..|:.||..:.....:||....:|::|..|.:.|..::.:::...:.||.:||:|||.:.::
Zfish     1 MLTTMEERLIAAVSDYPELYNSTINSYKDAARKAKAWRAVSLQVEIPEEDCRRRWKSLRDMFIKD 65

  Fly   376 HKRLRTLMHIDATSR--WKHYNSLSFLQKYIQQKTLESDSQLSMLLPKNDPVRELED 430
             ||.........||.  ||:...:|||..:||.::|.:|.      |:.|  |:.||
Zfish    66 -KRAEQRRRASGTSHRSWKYSWQMSFLTPFIQSRSLAADE------PEED--RDDED 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8765NP_649141.1 MADF 42..123 CDD:214738
MADF 318..405 CDD:214738 24/88 (27%)
LOC100330838NP_001373242.1 MADF 8..96 CDD:214738 24/88 (27%)
BESS 167..200 CDD:397204
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CZ6Y
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1634040at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.