DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oat and ETNPPL

DIOPT Version :9

Sequence 1:NP_649139.1 Gene:Oat / 40145 FlyBaseID:FBgn0022774 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_112569.2 Gene:ETNPPL / 64850 HGNCID:14404 Length:499 Species:Homo sapiens


Alignment Length:461 Identity:115/461 - (24%)
Similarity:202/461 - (43%) Gaps:96/461 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 VYARENKYGAHNYH--PL--------PVALTKGEGVFVWDVEGKRYFDYLSAYSAVNQGHCHPKI 91
            :|::.:..|....|  |.        |:.:.:.:..:::|..|::|.|.::  :..:.|||||.:
Human     4 LYSKRDTLGLRKKHIGPSCKVFFASDPIKIVRAQRQYMFDENGEQYLDCIN--NVAHVGHCHPGV 66

  Fly    92 VAALTAQASKLALTSRAFYSDVLGEYEEYVTKLFGFDKVLP--------MNTGVEGGETACKLAR 148
            |.|...|...|...||..:.:::    ||..:|   ...||        .|:|.|..:.|.:|||
Human    67 VKAALKQMELLNTNSRFLHDNIV----EYAKRL---SATLPEKLSVCYFTNSGSEANDLALRLAR 124

  Fly   149 KW--------------GYLEKKIPANQAKIIFARNNFWGRTLSA--VSASNDPSSYEGFGPFMPG 197
            ::              |:|...|..:..|  |.:    |:.:..  |..:..|.:|.|       
Human   125 QFRGHQDVITLDHAYHGHLSSLIEISPYK--FQK----GKDVKKEFVHVAPTPDTYRG------- 176

  Fly   198 FELIEY-----DNVSALEESLK---------DPNVCAFMVEPIQGEAGVVVPSDGYLKKVRELCT 248
                :|     |:.||..:.:|         ...:.||:.|.:|...|.::|..||.:||.|...
Human   177 ----KYREDHADSASAYADEVKKIIEDAHNSGRKIAAFIAESMQSCGGQIIPPAGYFQKVAEYVH 237

  Fly   249 KYNVLWIADEVQTGLARTGK---LLAVDYEQVQPDILILGKALSGGMYPVSAVLCNDQVMLCIKP 310
            ....::||||||.|..|.||   ...:..|...|||:.:||.:..| :||:.|:...::......
Human   238 GAGGVFIADEVQVGFGRVGKHFWSFQMYGEDFVPDIVTMGKPMGNG-HPVACVVTTKEIAEAFSS 301

  Fly   311 G--EHGSTYGGNPLGCRVAMAALEVLQEEKLAENAFKMGDLLRNELSTLPK---DVVSVVRGKGL 370
            .  |:.:||||||:.|.|.:|.|::::.|.|..||.::|:.| .||....|   .::..:||.||
Human   302 SGMEYFNTYGGNPVSCAVGLAVLDIIENEDLQGNAKRVGNYL-TELLKKQKAKHTLIGDIRGIGL 365

  Fly   371 LNAIVINQKF--------DAWEVCLRLKENGLL--AKPTHGDIIRFAPPLVINETQMRESIDIIR 425
            ...|.:.:..        :|..:..::||..:|  |...|.::::..||:...|...:..:|.:.
Human   366 FIGIDLVKDHLKRTPATAEAQHIIYKMKEKRVLLSADGPHRNVLKIKPPMCFTEEDAKFMVDQLD 430

  Fly   426 K--TIL 429
            :  |:|
Human   431 RILTVL 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OatNP_649139.1 Orn_aminotrans 34..429 CDD:273853 114/459 (25%)
argD 48..428 CDD:273228 111/447 (25%)
ETNPPLNP_112569.2 PRK06148 <6..441 CDD:180426 114/459 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 468..499
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D145181at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.