DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oat and CG8745

DIOPT Version :9

Sequence 1:NP_649139.1 Gene:Oat / 40145 FlyBaseID:FBgn0022774 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_648665.1 Gene:CG8745 / 39530 FlyBaseID:FBgn0036381 Length:494 Species:Drosophila melanogaster


Alignment Length:453 Identity:115/453 - (25%)
Similarity:195/453 - (43%) Gaps:94/453 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 SRSELVYARENKYGAH---NYHPLPVALTKGEGVFVWDVEGKRYFDYLSAYSAVNQGHCHPKIVA 93
            |::|.:..|....|..   .|...|:.:.:|:|.:::|.||.||.|.::  :..:.|||||::|.
  Fly    17 SKTETIKLRNQHIGQACQLFYRSDPLKIVRGQGQYMFDEEGTRYLDCIN--NVAHVGHCHPEVVR 79

  Fly    94 ALTAQASKLALTSRAFYSDVLGEYEEYVTKLFGFDKVLP--------MNTGVEGGETACKLARKW 150
            |...|.:.:: |:..|..|.|.:....:|      ..:|        :|:|.|..:.|.:|||.:
  Fly    80 AGALQMATIS-TNNRFLHDELVQCARTLT------SKMPEPLSVCFFVNSGSEANDLALRLARNF 137

  Fly   151 GYLEKKIPANQAKIIFARNNFWGRTLSAVSAS----NDPSSYEGFGPFMPGF------------- 198
                    ..:..:|...:.:.|...|.:..|    |.|.     |...|.:             
  Fly   138 --------TKRQDVITLDHAYHGHLQSVMEVSPYKFNQPG-----GEAKPDYVHVAPCPDVYGGK 189

  Fly   199 ---ELIEYDNVSAL----------EESLKDPNVCAFMVEPIQGEAGVVVPSDGYLKKVRELCTKY 250
               ::....::.||          ::..|...|.||:.|.:|...|.::|..||.:.|.:.....
  Fly   190 FTDKMYPDADMGALYAQPIEEICQKQLAKGQGVAAFIAESLQSCGGQILPPAGYFQAVYDAVRSA 254

  Fly   251 NVLWIADEVQTGLARTGK-LLAVDYEQVQPDILILGKALSGGMYPVSAVLCNDQVMLCIKPGEHG 314
            ..:.||||||.|..|.|. ..|.:.:.|.|||:.:.|.:..| :||.||:...::....    |.
  Fly   255 GGVCIADEVQVGFGRVGSHYWAFETQNVIPDIVCVAKPMGNG-HPVGAVVTTPEIAQAF----HA 314

  Fly   315 ------STYGGNPLGCRVAMAALEVLQEEKLAENAFKMGDLLRNELSTLPK--DVVSVVRGKGLL 371
                  :||||||:.|.:|.|.:.|::||.|.:.|..:||.|..|.:.|.:  :.:..|||.||.
  Fly   315 TGVAYFNTYGGNPVSCAIANAVMRVIEEEGLQQKALVLGDYLLEECNRLKQEFECIGDVRGAGLF 379

  Fly   372 NAI---------VINQKFDAWEVCLRLKENGLLAKPTHG---DIIRFAPPLVINETQMRESID 422
            ..|         :.::|...| |..|:|:...:...:.|   ::|:..||:..|    ||:.|
  Fly   380 VGIELVQDRKERIPDKKAAHW-VVNRMKQLHRVLVSSDGPNDNVIKLKPPMCFN----RENAD 437

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OatNP_649139.1 Orn_aminotrans 34..429 CDD:273853 114/451 (25%)
argD 48..428 CDD:273228 111/434 (26%)
CG8745NP_648665.1 GabT 20..450 CDD:223238 114/450 (25%)
OAT_like 37..447 CDD:99735 111/433 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439930
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D145181at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.