DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rnf146 and Ppp1r14bl

DIOPT Version :9

Sequence 1:NP_001137978.1 Gene:Rnf146 / 40144 FlyBaseID:FBgn0036897 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_080022.2 Gene:Ppp1r14bl / 66755 MGIID:1914005 Length:153 Species:Mus musculus


Alignment Length:87 Identity:18/87 - (20%)
Similarity:31/87 - (35%) Gaps:26/87 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   194 WYYEGRNGWWQYDDRTSQDIEDAFKKGDKSCTILVAGYVYIVDLEQLVQQRQNEPTRCRRVKRDL 258
            |..|...|.:...:....::|                    :|:::|:.. :::.||..|||..|
Mouse    80 WILEQLTGLYDCKEEEIPELE--------------------IDVDELLDM-ESDDTRAARVKELL 123

  Fly   259 ATIPKKGVAGL-----RIEGNQ 275
            ....|...|.:     ||.|.|
Mouse   124 VDCYKPTEAFINDLLDRIRGMQ 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rnf146NP_001137978.1 RING 123..165 CDD:238093
WWE 192..264 CDD:128922 12/69 (17%)
Ppp1r14blNP_080022.2 PP1_inhibitor 23..146 CDD:283108 18/87 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0824
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.