DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rnf146 and rnf146

DIOPT Version :9

Sequence 1:NP_001137978.1 Gene:Rnf146 / 40144 FlyBaseID:FBgn0036897 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_001008060.1 Gene:rnf146 / 493422 XenbaseID:XB-GENE-974778 Length:316 Species:Xenopus tropicalis


Alignment Length:280 Identity:118/280 - (42%)
Similarity:166/280 - (59%) Gaps:35/280 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 EDSPSAA--AAALECPICLQTCIHPARLPCGHIFCFLCVKGVAYKNRRCAMCRREIPAEFLDHPQ 174
            |..|::|  .:..||.||||||:||..|||.||||:|||||.::..||||:||:|||.:|||.|.
 Frog    22 EPCPNSAPSLSVPECAICLQTCVHPVSLPCKHIFCYLCVKGASWLGRRCALCRQEIPEDFLDKPT 86

  Fly   175 LVNGIEDICTTRATEDGFQWYYEGRNGWWQYDDRTSQDIEDAFKKGDKSCTILVAGYVYIVDLEQ 239
            |::. |::.:.......:.|||||||||||||:|||:::||||.||.||..:|:||::|:.|||.
 Frog    87 LLSP-EELKSASRGNGEYAWYYEGRNGWWQYDERTSRELEDAFTKGKKSTEMLIAGFLYVADLEN 150

  Fly   240 LVQQRQNEPTRCRRVKRDLATIPKKGVAGLRIE-----------------GNQVTSDTVFSRPT- 286
            :||.|:||..|.|::|||:..||||||||||:|                 .|........|:|| 
 Frog   151 MVQYRRNEHGRRRKIKRDIVDIPKKGVAGLRLECDAANVNLARESSADGADNMAALGASSSQPTP 215

  Fly   287 ------NTANPTTV--AAAASSFISTIAATDAAIRIASDIIG-STLAHADELTRGLTASNLNDDL 342
                  :|:..||.  |.:.|...|::..:.|.::|...:|| :.:...:|   |....|.....
 Frog   216 VLPTRLHTSLSTTASHALSHSDVTSSLENSFAQLQIGDPVIGRNNIGEGEE---GQPLINARMPA 277

  Fly   343 SSS-GEQSNSTNSNDAGRSP 361
            .|: .|:|..::|||.| ||
 Frog   278 PSALLEESEPSDSNDHG-SP 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rnf146NP_001137978.1 RING 123..165 CDD:238093 28/41 (68%)
WWE 192..264 CDD:128922 43/71 (61%)
rnf146NP_001008060.1 RING-HC_RNF146 35..74 CDD:319460 26/38 (68%)
RING-HC finger (C3HC4-type) 36..73 CDD:319460 25/36 (69%)
WWE 103..175 CDD:128922 43/71 (61%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 257..316 13/44 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 99 1.000 Domainoid score I6995
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004614
OrthoInspector 1 1.000 - - oto102593
Panther 1 1.100 - - LDO PTHR13417
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2954
SonicParanoid 1 1.000 - - X3820
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.040

Return to query results.
Submit another query.