powered by:
Protein Alignment Rnf146 and Ppp1r14b
DIOPT Version :9
Sequence 1: | NP_001137978.1 |
Gene: | Rnf146 / 40144 |
FlyBaseID: | FBgn0036897 |
Length: | 448 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_742042.1 |
Gene: | Ppp1r14b / 259225 |
RGDID: | 628702 |
Length: | 147 |
Species: | Rattus norvegicus |
Alignment Length: | 44 |
Identity: | 14/44 - (31%) |
Similarity: | 17/44 - (38%) |
Gaps: | 8/44 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 53 SAAAAAAAAAAAHSGGGSG--------EDPAVGSASGAAASDTD 88
|..|..||.||...|.||| :.|...:..|...:|.|
Rat 4 SGPAGGAALAAPAPGPGSGSTGPRVYFQSPPGAAGEGPGGADDD 47
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG0824 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.