DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rnf146 and C26B9.6

DIOPT Version :9

Sequence 1:NP_001137978.1 Gene:Rnf146 / 40144 FlyBaseID:FBgn0036897 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_508904.2 Gene:C26B9.6 / 182932 WormBaseID:WBGene00016135 Length:306 Species:Caenorhabditis elegans


Alignment Length:191 Identity:49/191 - (25%)
Similarity:84/191 - (43%) Gaps:45/191 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 CPICLQTCIHPARLP-CGHIFCFLCVKGVAYKNRRCAMCRREI-PAEF-------LD-HPQLVNG 178
            |.||......|.|:. |||.||::|:|........|.:||.:| |:.|       || |.|....
 Worm   107 CYICYYKLTIPTRIENCGHEFCYVCLKSNFAMGNDCPVCRGKISPSLFSMPIRYDLDIHMQCPED 171

  Fly   179 IEDIC----------------------------TTRATEDGFQWYYEGRN-GWWQYDDRTSQDIE 214
            ..|.|                            :.|.|.:.:.|.||..: |:::||.:..:.:|
 Worm   172 YADECADMVDRDHFRKSYIKGQEPTKSKPTLRRSKRTTREKYYWIYESSSFGYYRYDPKDEKYLE 236

  Fly   215 DAFKKGDKSCTILVAGYVYIVDLEQLVQQRQNEPTRC--RRVKRDLAT-IPK---KGVAGL 269
            :.:.:..::|.:.:.|...:::::..||::.....||  |::.|..|| |.|   ||:||:
 Worm   237 ECYCRKMETCVMRICGTAMLINIKDGVQEQVENEVRCTRRKILRIKATEIEKYNIKGIAGI 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rnf146NP_001137978.1 RING 123..165 CDD:238093 15/41 (37%)
WWE 192..264 CDD:128922 19/78 (24%)
C26B9.6NP_508904.2 WWE 10..83 CDD:128922
RING 107..149 CDD:238093 15/41 (37%)
WWE 213..288 CDD:128922 18/74 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 47 1.000 Domainoid score I8091
eggNOG 1 0.900 - - E1_KOG0824
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5209
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004614
OrthoInspector 1 1.000 - - otm14634
orthoMCL 1 0.900 - - OOG6_107506
Panther 1 1.100 - - O PTHR13417
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.760

Return to query results.
Submit another query.