DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rnf146 and Y105E8A.14

DIOPT Version :9

Sequence 1:NP_001137978.1 Gene:Rnf146 / 40144 FlyBaseID:FBgn0036897 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_740943.2 Gene:Y105E8A.14 / 173308 WormBaseID:WBGene00013674 Length:224 Species:Caenorhabditis elegans


Alignment Length:190 Identity:57/190 - (30%)
Similarity:82/190 - (43%) Gaps:43/190 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 ECPICLQTCIHPARLP-CGHIFCFLCVKGVAYKNR-RCAMCRREIPAEFLDHP-QLVNGIEDICT 184
            ||.:|....|.|..:| |||.|||:|:|||:..|. .|.:||..|.::....| |.|:...||..
 Worm    23 ECAVCYSEMILPTTIPSCGHKFCFICLKGVSVSNNGDCPICRGPIDSQIFKKPLQAVDLKMDIPG 87

  Fly   185 T-----------------------------------RATEDGFQWYYEGRN-GWWQYDDRTSQDI 213
            |                                   .|......|.|.||: |||::|.|..::|
 Worm    88 TPSAAAPDPVVKQEVDDEDVKPDVKKLQEELKKQQAAAAAQKMFWLYRGRHQGWWRFDPRIEKEI 152

  Fly   214 EDAFKKGDKSCTILVAGYVYIVDLEQLVQQRQNEPTRCRRVKR----DLATIPKKGVAGL 269
            |:||........:.:.|..||||..|:.|..:|:....|.|||    |..::..||::|:
 Worm   153 EEAFTHQMPMTEVTICGNPYIVDFSQMCQYPKNQSNYSRNVKRVNSTDFDSLNVKGMSGV 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rnf146NP_001137978.1 RING 123..165 CDD:238093 20/43 (47%)
WWE 192..264 CDD:128922 26/76 (34%)
Y105E8A.14NP_740943.2 RING 23..67 CDD:238093 20/43 (47%)
WWE 130..202 CDD:128922 26/71 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160159499
Domainoid 1 1.000 62 1.000 Domainoid score I6840
eggNOG 1 0.900 - - E1_KOG0824
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5209
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004614
OrthoInspector 1 1.000 - - otm14634
orthoMCL 1 0.900 - - OOG6_107506
Panther 1 1.100 - - LDO PTHR13417
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2954
SonicParanoid 1 1.000 - - X3820
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.680

Return to query results.
Submit another query.