DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wnd and AT1G73660

DIOPT Version :9

Sequence 1:NP_649137.3 Gene:wnd / 40143 FlyBaseID:FBgn0036896 Length:977 Species:Drosophila melanogaster
Sequence 2:NP_177507.1 Gene:AT1G73660 / 843701 AraportID:AT1G73660 Length:1030 Species:Arabidopsis thaliana


Alignment Length:273 Identity:104/273 - (38%)
Similarity:154/273 - (56%) Gaps:20/273 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 KSQRSE-----DWQIPFESITELEWLGSGAQGAVFSGRLKNETVAVKKV-------KELKE--TD 197
            :|.:|:     |.:|.:|.||..|.:|.|:.|.|:.|......|||||.       :.|:|  ::
plant   729 ESSKSDCDDVSDCEILWEEITVGERIGLGSYGEVYRGDWHGTEVAVKKFLDQDLTGEALEEFRSE 793

  Fly   198 IKHLRKLDHENIIKFKGVCTQSPVFCIIMEFCPYGPLQNILKEEQVMLPS-RLVSWSKQIALGMQ 261
            ::.::||.|.||:.|.|..|:.|...|:.||.|.|.|..::......|.. |.:..:...|.||.
plant   794 VRIMKKLRHPNIVLFMGAVTRPPNLSIVTEFLPRGSLYRLIHRPNNQLDERRRLRMALDAARGMN 858

  Fly   262 YLHS--HKIIHRDLKSPNILISTNEVVKISDFGTSREWNE--ISTKMSFAGTVAWMAPEVIRNEP 322
            ||||  ..|:||||||||:|:..|.|||:.|||.||..:.  :|:| |.|||..||||||:||||
plant   859 YLHSCNPMIVHRDLKSPNLLVDKNWVVKVCDFGLSRMKHSTYLSSK-STAGTAEWMAPEVLRNEP 922

  Fly   323 CSEKVDIWSYGVVLWEMLTCEIPYKDVDSSAIIWGVGNNSLKLLVPSTCPEGFKLLVKLCWKSKP 387
            ..||.|::||||:|||:.|.:.|:..::...::..||....:|.:|.........|:..||::..
plant   923 ADEKCDVYSYGVILWELFTLQQPWGKMNPMQVVGAVGFQHRRLDIPDFVDPAIADLISKCWQTDS 987

  Fly   388 RNRPSFRQILSHL 400
            :.||||.:|::.|
plant   988 KLRPSFAEIMASL 1000

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wndNP_649137.3 STYKc 161..400 CDD:214568 98/252 (39%)
STKc_MAP3K12_13 167..403 CDD:270961 96/248 (39%)
AT1G73660NP_177507.1 EDR1 179..383 CDD:316869
STKc_MAP3K-like 754..1000 CDD:270901 95/246 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 173 1.000 Domainoid score I1116
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1208
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X966
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.