DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wnd and AT1G67890

DIOPT Version :9

Sequence 1:NP_649137.3 Gene:wnd / 40143 FlyBaseID:FBgn0036896 Length:977 Species:Drosophila melanogaster
Sequence 2:NP_564913.1 Gene:AT1G67890 / 843117 AraportID:AT1G67890 Length:765 Species:Arabidopsis thaliana


Alignment Length:295 Identity:105/295 - (35%)
Similarity:166/295 - (56%) Gaps:24/295 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 DWQIPFESITELEWLGSGAQGAVFSGRLKNETVAVK--KVKELKE-------TDIKHLRKLDHEN 208
            |::|.:|.:|..|.:|.|:.|.|:.|......||||  ..:|..|       .::..:::|.|.|
plant   479 DYEILWEDLTIGEQIGQGSCGTVYHGLWFGSDVAVKVFSKQEYSEEIITSFKQEVSLMKRLRHPN 543

  Fly   209 IIKFKGVCTQSPVFCIIMEFCPYGPLQNILKEEQVMLP-SRLVSWSKQIALGMQYLH--SHKIIH 270
            ::.|.|........||:.||.|.|.|..:|:..:..|. .|.:..:..||.||.|||  |..|||
plant   544 VLLFMGAVASPQRLCIVTEFLPRGSLFRLLQRNKSKLDLRRRIHMASDIARGMNYLHHCSPPIIH 608

  Fly   271 RDLKSPNILISTNEVVKISDFGTSREWNEISTKMSFAGTVAWMAPEVIRNEPCSEKVDIWSYGVV 335
            |||||.|:|:..|..||::|||.||..:|.....:..||..||||||:|||...||.|::|:|||
plant   609 RDLKSSNLLVDRNWTVKVADFGLSRIKHETYLTTNGRGTPQWMAPEVLRNEAADEKSDVYSFGVV 673

  Fly   336 LWEMLTCEIPYKDVDSSAIIWGVGNNSLKLLVPSTCPEGFKLLVKLCWKSKPRNRPSFRQILSHL 400
            |||::|.:||::::::..:|..||..:.:|.||......:..|::.||.|:|:.||||::::   
plant   674 LWELVTEKIPWENLNAMQVIGAVGFMNQRLEVPKDVDPQWIALMESCWHSEPQCRPSFQELM--- 735

  Fly   401 DIAGPELLRKTEKQY---FETQKSWKEEVRSHLKE 432
                 :.||:.:::|   |:..::...: .|.|||
plant   736 -----DKLRELQRKYTIQFQAARAASID-NSSLKE 764

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wndNP_649137.3 STYKc 161..400 CDD:214568 94/250 (38%)
STKc_MAP3K12_13 167..403 CDD:270961 92/247 (37%)
AT1G67890NP_564913.1 PAS 101..211 CDD:395786
STKc_MAP3K-like 493..738 CDD:270901 92/252 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 173 1.000 Domainoid score I1116
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1208
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X966
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.