DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wnd and CIPK9

DIOPT Version :9

Sequence 1:NP_649137.3 Gene:wnd / 40143 FlyBaseID:FBgn0036896 Length:977 Species:Drosophila melanogaster
Sequence 2:NP_849571.1 Gene:CIPK9 / 839349 AraportID:AT1G01140 Length:451 Species:Arabidopsis thaliana


Alignment Length:392 Identity:91/392 - (23%)
Similarity:158/392 - (40%) Gaps:82/392 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   169 SGAQGAVFSGRLKNETVAVKKVKELKETDIKHLRKLDHENIIKFKGVCTQSPVFCIIMEFCPYGP 233
            :|.|.|:  ..|..|.|...|:.|..:.:|..::.:.|.|:::...|........|::|....|.
plant    41 TGDQAAI--KILDREKVFRHKMVEQLKREISTMKLIKHPNVVEIIEVMASKTKIYIVLELVNGGE 103

  Fly   234 L------QNILKEEQVMLPSRLVSWSKQIALGMQYLHSHKIIHRDLKSPNILISTNEVVKISDFG 292
            |      |..|||::..      .:.:|:...:.|.||..:.|||||..|:::..|.|:|:||||
plant   104 LFDKIAQQGRLKEDEAR------RYFQQLINAVDYCHSRGVYHRDLKPENLILDANGVLKVSDFG 162

  Fly   293 T---SREWNEISTKMSFAGTVAWMAPEVIRNEPCSEK------VDIWSYGVVLWEMLTCEIPYKD 348
            .   ||:..|.....:..||..::||||:     |:|      .|:||.||:|:.::...:|:.:
plant   163 LSAFSRQVREDGLLHTACGTPNYVAPEVL-----SDKGYDGAAADVWSCGVILFVLMAGYLPFDE 222

  Fly   349 VDSSAIIWGVGNNSLKLLVPSTCP----EGFKLLVKLC------------------WKSKPRNRP 391
            .:...:...:.....      :||    :|.|.::|..                  |..|....|
plant   223 PNLMTLYKRICKAEF------SCPPWFSQGAKRVIKRILEPNPITRISIAELLEDEWFKKGYKPP 281

  Fly   392 SFRQILSHLDIAGPELLRKTEKQYFETQKSWKEEVRSHLKEITQNG----TNIHKYEQDLIKRRT 452
            ||.|....:.|...:......|:...|:|..|....:..:.|:.:.    .|:.:.:..|:|:.|
plant   282 SFDQDDEDITIDDVDAAFSNSKECLVTEKKEKPVSMNAFELISSSSEFSLENLFEKQAQLVKKET 346

  Fly   453 AEWRHAQDIRMVYEDKLQKTNQLFFELSECMSQLQEKEKEIAERERKLPGSGYKPNRRFGNTIRK 517
                             :.|:|.  ..||.||:::|..|.:....||   ..||...:...:.||
plant   347 -----------------RFTSQR--SASEIMSKMEETAKPLGFNVRK---DNYKIKMKGDKSGRK 389

  Fly   518 MQ 519
            .|
plant   390 GQ 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wndNP_649137.3 STYKc 161..400 CDD:214568 66/267 (25%)
STKc_MAP3K12_13 167..403 CDD:270961 66/270 (24%)
CIPK9NP_849571.1 S_TKc 19..274 CDD:214567 60/251 (24%)
STKc_SnRK3 19..273 CDD:271133 60/250 (24%)
CIPK_C 318..437 CDD:213380 20/96 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.