DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wnd and AT1G18160

DIOPT Version :9

Sequence 1:NP_649137.3 Gene:wnd / 40143 FlyBaseID:FBgn0036896 Length:977 Species:Drosophila melanogaster
Sequence 2:NP_173254.2 Gene:AT1G18160 / 838395 AraportID:AT1G18160 Length:992 Species:Arabidopsis thaliana


Alignment Length:261 Identity:103/261 - (39%)
Similarity:150/261 - (57%) Gaps:17/261 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 QIPFESITELEWLGSGAQGAVFSGRLKNETVAVKKV-------KELKE--TDIKHLRKLDHENII 210
            :|.:|.||..|.:|.|:.|.|:.|......|||||.       :.|:|  ::::.:|:|.|.||:
plant   709 EILWEEITVAERIGLGSYGEVYRGDWHGTAVAVKKFIDQDITGEALEEFRSEVRMMRRLRHPNIV 773

  Fly   211 KFKGVCTQSPVFCIIMEFCPYGPLQNILKEEQVMLPSR-LVSWSKQIALGMQYLHSHK--IIHRD 272
            .|.|..|:.|...|:.||.|.|.|..::......|..| .:..:...|.||.||||..  |:|||
plant   774 LFMGAVTRPPNLSIVTEFLPRGSLYRLIHRPNNQLDERKRLRMALDAARGMNYLHSCNPVIVHRD 838

  Fly   273 LKSPNILISTNEVVKISDFGTSREWNEISTKM---SFAGTVAWMAPEVIRNEPCSEKVDIWSYGV 334
            |||||:|:..|.|||:.|||.||  .::||.:   |.|||..||||||:||||..||.|::||||
plant   839 LKSPNLLVDKNWVVKVCDFGLSR--MKVSTYLSSKSTAGTAEWMAPEVLRNEPADEKCDVYSYGV 901

  Fly   335 VLWEMLTCEIPYKDVDSSAIIWGVGNNSLKLLVPSTCPEGFKLLVKLCWKSKPRNRPSFRQILSH 399
            :|||:.|.:.|:..::...::..||....:|.:|.....|...:::.||::.||.||||.:|:..
plant   902 ILWELFTLQQPWGKMNPMQVVGAVGFQHRRLDIPEFVDPGIADIIRKCWQTDPRLRPSFGEIMDS 966

  Fly   400 L 400
            |
plant   967 L 967

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wndNP_649137.3 STYKc 161..400 CDD:214568 100/253 (40%)
STKc_MAP3K12_13 167..403 CDD:270961 98/249 (39%)
AT1G18160NP_173254.2 EDR1 154..359 CDD:373038
STKc_MAP3K-like 721..967 CDD:270901 97/247 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 173 1.000 Domainoid score I1116
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1208
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X966
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.