DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wnd and AT5G11850

DIOPT Version :10

Sequence 1:NP_649137.3 Gene:wnd / 40143 FlyBaseID:FBgn0036896 Length:977 Species:Drosophila melanogaster
Sequence 2:NP_196746.2 Gene:AT5G11850 / 831058 AraportID:AT5G11850 Length:880 Species:Arabidopsis thaliana


Alignment Length:66 Identity:16/66 - (24%)
Similarity:23/66 - (34%) Gaps:15/66 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 VHALEPQEQIDFRFRVNLRRTTTYTCTFSWPGNAKTFDIFRVDRDDNSKSTCGICRECIWYICET 132
            :.|:|....:|.|.....|.||..|.   ...:.....|:..|:.|        ||:    .|.|
plant   297 ISAMERFRNMDKRATAEDRNTTLETL---HQNSITQVSIYDGDKTD--------CRK----FCTT 346

  Fly   133 G 133
            |
plant   347 G 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wndNP_649137.3 STKc_MAP3K12_13 167..403 CDD:270961
AT5G11850NP_196746.2 EDR1 140..343 CDD:433922 13/60 (22%)
STKc_MAP3K-like 615..861 CDD:270901
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.