DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wnd and AT3G06640

DIOPT Version :9

Sequence 1:NP_649137.3 Gene:wnd / 40143 FlyBaseID:FBgn0036896 Length:977 Species:Drosophila melanogaster
Sequence 2:NP_187316.2 Gene:AT3G06640 / 819844 AraportID:AT3G06640 Length:730 Species:Arabidopsis thaliana


Alignment Length:294 Identity:105/294 - (35%)
Similarity:161/294 - (54%) Gaps:19/294 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 DWQIPFESITELEWLGSGAQGAVFSGRLKNETVAVKKV--KELKETDIKHLR-------KLDHEN 208
            :::|.::.:|..|.:|.|:.|.|:.|......||||.:  :|..|..|:..|       :|.|.|
plant   438 EYEILWDDLTIGEQIGQGSCGTVYHGLWFGSDVAVKLISKQEYSEEVIQSFRQEVSLMQRLRHPN 502

  Fly   209 IIKFKGVCTQSPVFCIIMEFCPYGPLQNILKEEQVMLP-SRLVSWSKQIALGMQYLH--SHKIIH 270
            ::.|.|..|.....||:.||.|.|.|..:|:.....|. .|.::.:..||.||.|||  |..|||
plant   503 VLLFMGAVTLPQGLCIVSEFLPRGSLFRLLQRNMSKLDWRRRINMALDIARGMNYLHRCSPPIIH 567

  Fly   271 RDLKSPNILISTNEVVKISDFGTSR-EWNEISTKMSFAGTVAWMAPEVIRNEPCSEKVDIWSYGV 334
            |||||.|:|:..|..||::|||.|| :.:...|..|..|...||||||:|||...||.||:|:||
plant   568 RDLKSSNLLVDKNLTVKVADFGLSRIKHHTYLTSKSGKGMPQWMAPEVLRNESADEKSDIYSFGV 632

  Fly   335 VLWEMLTCEIPYKDVDSSAIIWGVGNNSLKLLVPSTCPEGFKLLVKLCWKSKPRNRPSFRQILSH 399
            ||||:.|.:||:::::|..:|..||..:.:|.:|......:..|::.||....:.||:|::::..
plant   633 VLWELATEKIPWENLNSMQVIGAVGFMNQRLEIPKDIDPDWISLIESCWHRDAKLRPTFQELMER 697

  Fly   400 LDIAGPELLRKTEKQYFETQKSWKEEVRSHLKEI 433
            |    .:|.||...|:..|:  |...||:...::
plant   698 L----RDLQRKYTIQFQATR--WLTMVRTESSQV 725

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wndNP_649137.3 STYKc 161..400 CDD:214568 95/251 (38%)
STKc_MAP3K12_13 167..403 CDD:270961 94/248 (38%)
AT3G06640NP_187316.2 PAS 64..175 CDD:279347
PAS 73..175 CDD:238075
STYKc 446..698 CDD:214568 95/251 (38%)
STKc_MAP3K-like 452..698 CDD:270901 93/245 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 173 1.000 Domainoid score I1116
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1208
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X966
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.