DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wnd and SRMS

DIOPT Version :9

Sequence 1:NP_649137.3 Gene:wnd / 40143 FlyBaseID:FBgn0036896 Length:977 Species:Drosophila melanogaster
Sequence 2:NP_543013.1 Gene:SRMS / 6725 HGNCID:11298 Length:488 Species:Homo sapiens


Alignment Length:267 Identity:85/267 - (31%)
Similarity:132/267 - (49%) Gaps:15/267 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 KSQRSEDWQIPFESITELEWLGSGAQGAVFSGR-LKNETVAVKKVK--ELKETD----IKHLRKL 204
            |:.|.:.|:.|.........||.|..|.|:.|. |.:..||:|.:|  .:|.||    |:.|:.|
Human   216 KAPRQDVWERPHSEFALGRKLGEGYFGEVWEGLWLGSLPVAIKVIKSANMKLTDLAKEIQTLKGL 280

  Fly   205 DHENIIKFKGVCTQSPVFCIIMEFCPYGPLQNIL---KEEQVMLPSRLVSWSKQIALGMQYLHSH 266
            .||.:|:...||:......|:.|....|.||..|   :...:.||. |:.::.|:|.||.||...
Human   281 RHERLIRLHAVCSGGEPVYIVTELMRKGNLQAFLGTPEGRALRLPP-LLGFACQVAEGMSYLEEQ 344

  Fly   267 KIIHRDLKSPNILISTNEVVKISDFGTSREWNE--ISTKMSFAGTVAWMAPEVIRNEPCSEKVDI 329
            :::||||.:.|:|:......|::|||.:|...:  .|...|....|.|.|||.......|:|.|:
Human   345 RVVHRDLAARNVLVDDGLACKVADFGLARLLKDDIYSPSSSSKIPVKWTAPEAANYRVFSQKSDV 409

  Fly   330 WSYGVVLWEMLTC-EIPYKDVDSSAIIWGVGNNSLKLLVPSTCPEGFKLLVKLCWKSKPRNRPSF 393
            ||:||:|.|:.|. :.||:.:.:...:..: ....:|..|:.||....:|:..||:|.|..||||
Human   410 WSFGVLLHEVFTYGQCPYEGMTNHETLQQI-MRGYRLPRPAACPAEVYVLMLECWRSSPEERPSF 473

  Fly   394 RQILSHL 400
            ..:...|
Human   474 ATLREKL 480

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wndNP_649137.3 STYKc 161..400 CDD:214568 80/251 (32%)
STKc_MAP3K12_13 167..403 CDD:270961 81/247 (33%)
SRMSNP_543013.1 SH3_Srms 55..109 CDD:212780
SH2 119..197 CDD:301589
PTKc_Srm_Brk 223..483 CDD:133248 83/260 (32%)
STYKc 232..480 CDD:214568 80/249 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.