DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wnd and PTK6

DIOPT Version :9

Sequence 1:NP_649137.3 Gene:wnd / 40143 FlyBaseID:FBgn0036896 Length:977 Species:Drosophila melanogaster
Sequence 2:NP_005966.1 Gene:PTK6 / 5753 HGNCID:9617 Length:451 Species:Homo sapiens


Alignment Length:270 Identity:86/270 - (31%)
Similarity:132/270 - (48%) Gaps:31/270 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 EDWQIPFESITELEWLGSGAQGAVFSGRLKNET-VAVKKV-------KELKETDIKHLRKLDHEN 208
            :||:.|.|..|....||||..|.||.|..|:.. ||:|.:       :::.:::|:.::||.|::
Human   182 DDWERPREEFTLCRKLGSGYFGEVFEGLWKDRVQVAIKVISRDNLLHQQMLQSEIQAMKKLRHKH 246

  Fly   209 IIKFKGVCTQSPVFCIIMEFCPYGPLQNILK--EEQVMLPSRLVSWSKQIALGMQYLHSHKIIHR 271
            |:....|.:......||.|....|.|..:|:  :|:|:..|.|:..:.|:|.||.||.|...|||
Human   247 ILALYAVVSVGDPVYIITELMAKGSLLELLRDSDEKVLPVSELLDIAWQVAEGMCYLESQNYIHR 311

  Fly   272 DLKSPNILISTNEVVKISDFGTSREWNEISTKMSFAGTV--AWMAPEVIRNEPCSEKVDIWSYGV 334
            ||.:.|||:..|.:.|:.|||.:|...| ...:|....:  .|.|||.:.....|.|.|:||:|:
Human   312 DLAARNILVGENTLCKVGDFGLARLIKE-DVYLSHDHNIPYKWTAPEALSRGHYSTKSDVWSFGI 375

  Fly   335 VLWEMLT-CEIPYKDVDSSAIIWGVGNNSLKLLV--------PSTCPEGFKLLVKLCWKSKPRNR 390
            :|.||.: .::||.         |:.|:...|.|        |..||.....|:..||...|..|
Human   376 LLHEMFSRGQVPYP---------GMSNHEAFLRVDAGYRMPCPLECPPSVHKLMLTCWCRDPEQR 431

  Fly   391 PSFRQILSHL 400
            |.|:.:...|
Human   432 PCFKALRERL 441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wndNP_649137.3 STYKc 161..400 CDD:214568 81/259 (31%)
STKc_MAP3K12_13 167..403 CDD:270961 81/255 (32%)
PTK6NP_005966.1 SH3_Brk 12..69 CDD:212781
SH2_PTK6_Brk 75..174 CDD:198221
Linker 171..190 3/7 (43%)
PTKc_Srm_Brk 184..444 CDD:133248 85/268 (32%)
STYKc 192..441 CDD:214568 81/258 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.