DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wnd and Takl2

DIOPT Version :9

Sequence 1:NP_649137.3 Gene:wnd / 40143 FlyBaseID:FBgn0036896 Length:977 Species:Drosophila melanogaster
Sequence 2:NP_651090.2 Gene:Takl2 / 42692 FlyBaseID:FBgn0039015 Length:281 Species:Drosophila melanogaster


Alignment Length:243 Identity:71/243 - (29%)
Similarity:122/243 - (50%) Gaps:18/243 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 IPFESITELEWLGSGAQGAVFSGRLKNETVAVKKVKE-----LKETDIKHLRKLDHENIIKFKGV 215
            :|:|.|...|.:|:|..|:|:....:|..:|:|:::|     ..|.:|..|.|..|.||::..|.
  Fly     8 VPYEEIQTKELIGTGFYGSVYRAVWRNREIALKRIREGCEDKKIEREIYQLTKASHVNIVELYGT 72

  Fly   216 CTQSPVFCIIMEFCPYGPLQNIL--KEEQVMLPSRLVSWSKQIALGMQYLHSHK---IIHRDLKS 275
            ........::|||...|.|.:.|  |.:.....:...:|:.|||.|:.|||..:   :||||:|.
  Fly    73 SRHEGCALLLMEFVDGGSLSSFLHAKSKPSYSHAHAFNWAHQIAQGIAYLHGMQPKAVIHRDIKP 137

  Fly   276 PNILISTNEV-VKISDFGTSREWNE-ISTKMSFAGTVAWMAPEVIRNEPCSEKVDIWSYGVVLWE 338
            .|.|:....: :||.||||..:.:: ||..   |||..:.||||::.....||.|::|:.:..||
  Fly   138 LNTLLCEKGLKLKICDFGTVVDLSQSISCN---AGTCRYKAPEVLQGNKPDEKCDVYSWAITFWE 199

  Fly   339 MLTCEIPYKDVDSSAIIWGVGNNSLK---LLVPSTCPEGFKLLVKLCW 383
            :|:.:.|::..::...::...|...:   ..:.|.||.....|:...|
  Fly   200 ILSRKEPFEQYNTLFELYMAINEGERPDLSCIMSGCPADIVALLYASW 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wndNP_649137.3 STYKc 161..400 CDD:214568 69/238 (29%)
STKc_MAP3K12_13 167..403 CDD:270961 67/232 (29%)
Takl2NP_651090.2 S_TKc 14..258 CDD:214567 68/237 (29%)
PKc_like 19..268 CDD:304357 67/232 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445248
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23257
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.