DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wnd and Lrrk

DIOPT Version :9

Sequence 1:NP_649137.3 Gene:wnd / 40143 FlyBaseID:FBgn0036896 Length:977 Species:Drosophila melanogaster
Sequence 2:NP_001262772.1 Gene:Lrrk / 42447 FlyBaseID:FBgn0038816 Length:2513 Species:Drosophila melanogaster


Alignment Length:1040 Identity:206/1040 - (19%)
Similarity:308/1040 - (29%) Gaps:504/1040 - (48%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SLSKSRDDLVTAASRQQQQLHGRRRHHGSSP----NLSLDQTDNLRRSMACLQDEFGHLG---IA 64
            ::|:..||       .::||....|.|.|..    .|::|..|.|      |:|.:..||   :.
  Fly  1568 NISQEVDD-------NERQLLAEIRPHMSQVAKLLALTVDHIDLL------LEDWYPSLGTRFVH 1619

  Fly    65 ATDLPFKSSDLDSPPR----LQHHNNYAEITDSSAENTCQQRWPPHVG----------GAGAAFG 115
            .::..|..:.|...||    ||...|          |....|..|.||          ||||.|.
  Fly  1620 TSEGRFLITRLVLCPRCLWKLQLQQN----------NEPSDREVPPVGCNRPSRSSRRGAGAYFL 1674

  Fly   116 HPDKPIGWMYGLLGCMKPVLSFIGKTGVIEV----------KSQRSED----------------- 153
            |            |...|     |:.|.:.|          :.:||||                 
  Fly  1675 H------------GVGDP-----GEDGALNVFSAYLNATARRERRSEDSLGAGSDADSGVGPDSA 1722

  Fly   154 -------------------------WQ-------------------------------------- 155
                                     |.                                      
  Fly  1723 GSSRNTSVDGHPGYHLPDNSNVCYAWMIEECILSVYNQSKISCPVHLEQSMAQLAPDVIFADIPD 1787

  Fly   156 ---IPFESITELEWLGSGAQGAVFSGRLK------NETVAVKKVKEL------KET--------- 196
               ||.|.|.:...||.||.|.||....|      .:.||:|.::.:      ||:         
  Fly  1788 KHTIPSECIIKGSLLGRGAFGFVFKANCKVRGARSFKPVAMKMLQPVPPGARAKESALMAFKVAV 1852

  Fly   197 ------DIKH--------------LRKLDHENIIKFKGVCTQSPVFCIIMEFCPYGPLQNILKEE 241
                  .::|              |..|.|.||:...|:|.:.  ..:::|..|.|.|..:|:..
  Fly  1853 GKWDRDPLQHSCKAYCTARQELAVLLTLKHPNIVPLVGICIKP--LALVLELAPLGGLDALLRHY 1915

  Fly   242 Q----VMLPSRLVSWSKQIALGMQYLHSHKIIHRDLKSPNILI-----------STNEV-VKISD 290
            :    .|.|....:...|.|..::|||..:||:|||||.|:|:           ..|.| :||:|
  Fly  1916 RRSGAHMGPHTFQTLVLQAARAIEYLHRRRIIYRDLKSENVLVWELPQPHTEDSPRNLVHIKIAD 1980

  Fly   291 FGTSREWNEISTKMSFAGTVAWMAPEVIR---NEPCSEKVDIWSYGVVLWEMLTCEIPYKDVDSS 352
            :|.||:......| .|.||..:||||:||   .|..:||||.:|:|:.::|.::...|::     
  Fly  1981 YGISRQTAPSGAK-GFGGTEGFMAPEIIRYNGEEEYTEKVDCFSFGMFIYENISLRQPFE----- 2039

  Fly   353 AIIWGVGNNSLKLLV---------------PSTCPEGFKLLVKLCWKSKPRNRPSFRQILSHLDI 402
                  |:.|:|..:               |:.|.:    |:.|||..:||.||:..||:|.|  
  Fly  2040 ------GHESIKECILEGSRPALTQRETQFPTCCLD----LMVLCWHEQPRRRPTASQIVSIL-- 2092

  Fly   403 AGPELLRKTEKQYFETQKSWKEEVRSHLKEITQNGTNIHKYEQDLIKRRTAEWRHAQDIRMVYED 467
            :.||.:                    ||.::.                                 
  Fly  2093 SAPECI--------------------HLLDVV--------------------------------- 2104

  Fly   468 KLQKTNQLFFELSECMSQLQEKEKEIAERERKLPGSGYKPNRRFGNTIRKMQHYRRRLNPAPAAI 532
                             .:...||.:....:.|.|.|                            
  Fly  2105 -----------------AMPHSEKIVCGVFQSLVGMG---------------------------- 2124

  Fly   533 QQQSTTPDPETTPESPVKCMLYAQLDS--------NCQPKSYL--ANIIPSSGLGAPMPNKNKKV 587
                   |.|       :|.|...|.|        :|.|...|  .|.|..|    |.|..    
  Fly  2125 -------DDE-------RCGLELWLPSFGSRIDILDCSPSGSLLQCNSISCS----PQPQV---- 2167

  Fly   588 FRHRRNASGSFGAPPKYSPTRDRRYQSEPEN------RKVQLVERQTQTDAMDVSET----DISP 642
                        ||||           .|||      |..|.:.:........|.|.    |:|.
  Fly  2168 ------------APPK-----------TPENGANSRARSAQRLPKMNMLCCCLVGEAIWMGDVSG 2209

  Fly   643 SAEAPR--------SQPIDVPVPNHRQLPLQLQRVQKIAQAQARARSGS---------------- 683
            :..|..        |..:|   ||.:...:.|..::|||:......:|.                
  Fly  2210 NLHAYSTSTYAHLFSYMLD---PNIKSAVISLVYMEKIARVAVGTHNGRVFLVDATQMPSNCAFA 2271

  Fly   684 ------TSSAAGAV-NPAC----------------------PSNGNSLSTSELTYQDACSSPD-Q 718
                  |...:|.| :.||                      |.|.|.:|    .:|..|.|.: .
  Fly  2272 EGSFVLTEICSGFVLHAACSVVVDGIYELWCGEIAGKINVFPLNENGVS----GHQALCHSEEPN 2332

  Fly   719 LIDDV----MNSNE-------------------------RLDMTECCSDNENLERLGRKVIEFIN 754
            ||:||    |.|||                         :||.::....:|:|:.:.  :.|.:|
  Fly  2333 LIEDVKVARMCSNESHVFSCLYPGCMVYQWDVISKRIENKLDCSKLLPCSESLQSIA--IDEHVN 2395

  Fly   755  754
              Fly  2396  2395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wndNP_649137.3 STYKc 161..400 CDD:214568 86/313 (27%)
STKc_MAP3K12_13 167..403 CDD:270961 86/310 (28%)
LrrkNP_001262772.1 Ank_2 111..200 CDD:289560
ANK 146..286 CDD:238125
ANK repeat 146..177 CDD:293786
Ank_4 179..232 CDD:290365
ANK repeat 179..209 CDD:293786
Ank_2 216..389 CDD:289560
ANK 361..477 CDD:238125
ANK repeat 361..390 CDD:293786
Ank_2 364..464 CDD:289560
ANK repeat 406..435 CDD:293786
ANK repeat 437..464 CDD:293786
LRR_8 <544..580 CDD:290566
leucine-rich repeat 547..569 CDD:275380
LRR_8 569..629 CDD:290566
leucine-rich repeat 570..595 CDD:275380
leucine-rich repeat 596..618 CDD:275380
leucine-rich repeat 619..641 CDD:275380
leucine-rich repeat 642..676 CDD:275380
leucine-rich repeat 677..730 CDD:275380
LRR_8 729..788 CDD:290566
leucine-rich repeat 731..754 CDD:275380
LRR_8 855..933 CDD:290566
leucine-rich repeat 855..901 CDD:275380
leucine-rich repeat 902..924 CDD:275380
leucine-rich repeat 925..949 CDD:275380
P-loop_NTPase 993..1211 CDD:304359
COR 1230..1471 CDD:292713
STYKc 1796..2092 CDD:214568 86/313 (27%)
STKc_LRRK 1801..2095 CDD:270902 86/313 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445226
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.