DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wnd and LYN

DIOPT Version :9

Sequence 1:NP_649137.3 Gene:wnd / 40143 FlyBaseID:FBgn0036896 Length:977 Species:Drosophila melanogaster
Sequence 2:XP_011515831.1 Gene:LYN / 4067 HGNCID:6735 Length:682 Species:Homo sapiens


Alignment Length:290 Identity:97/290 - (33%)
Similarity:158/290 - (54%) Gaps:26/290 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 IEVKSQRSED---WQIPFESITELEWLGSGAQGAVFSGRLKNET-VAVKKVKE--------LKET 196
            |..|.|:..|   |:||.|||..::.||:|..|.|:.|...|.| ||||.:|.        |:|.
Human   397 ISPKPQKPWDKDAWEIPRESIKLVKRLGAGQFGEVWMGYYNNSTKVAVKTLKPGTMSVQAFLEEA 461

  Fly   197 DIKHLRKLDHENIIKFKGVCTQSPVFCIIMEFCPYGPLQNILKEEQ---VMLPSRLVSWSKQIAL 258
            ::  ::.|.|:.:::...|.|:.....||.|:...|.|.:.||.::   |:|| :|:.:|.|||.
Human   462 NL--MKTLQHDKLVRLYAVVTREEPIYIITEYMAKGSLLDFLKSDEGGKVLLP-KLIDFSAQIAE 523

  Fly   259 GMQYLHSHKIIHRDLKSPNILISTNEVVKISDFGTSR--EWNEISTKMSFAGTVAWMAPEVIRNE 321
            ||.|:.....|||||::.|:|:|.:.:.||:|||.:|  |.||.:.:......:.|.|||.|...
Human   524 GMAYIERKNYIHRDLRAANVLVSESLMCKIADFGLARVIEDNEYTAREGAKFPIKWTAPEAINFG 588

  Fly   322 PCSEKVDIWSYGVVLWEMLTC-EIPYKDVDSSAIIWGVGNNSLKLLVPSTCPEGFKLLVKLCWKS 385
            ..:.|.|:||:|::|:|::|. :|||....::.::..: :...::.....||:....::|:|||.
Human   589 CFTIKSDVWSFGILLYEIVTYGKIPYPGRTNADVMTAL-SQGYRMPRVENCPDELYDIMKMCWKE 652

  Fly   386 KPRNRPSFRQILSHLDIAGPELLRKTEKQY 415
            |...||:|..:.|.||    :....||.||
Human   653 KAEERPTFDYLQSVLD----DFYTATEGQY 678

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wndNP_649137.3 STYKc 161..400 CDD:214568 82/253 (32%)
STKc_MAP3K12_13 167..403 CDD:270961 83/250 (33%)
LYNXP_011515831.1 SH3_Lyn 237..292 CDD:212937
SH2_Src_Lyn 295..395 CDD:198227
PTKc_Lyn 409..680 CDD:270657 93/278 (33%)
Pkinase_Tyr 417..667 CDD:285015 82/253 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.