DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wnd and Mos

DIOPT Version :9

Sequence 1:NP_649137.3 Gene:wnd / 40143 FlyBaseID:FBgn0036896 Length:977 Species:Drosophila melanogaster
Sequence 2:NP_610817.1 Gene:Mos / 36404 FlyBaseID:FBgn0033773 Length:364 Species:Drosophila melanogaster


Alignment Length:340 Identity:81/340 - (23%)
Similarity:133/340 - (39%) Gaps:105/340 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 TELEWLGSGAQGAVFSGRLKNETVAVKKVKELKETDI---KHLRKLDHENIIKFKGVCTQSPVFC 223
            |..:.||.||.|.||....::.:||||.::....:.:   .||..|:|.||::...:.:.:....
  Fly    23 TRCQVLGRGAYGTVFKAIYRDRSVAVKIIRAQAASTLHNESHLLNLEHRNIVRLLKLESAADFGL 87

  Fly   224 IIMEFCPYG-PLQNILKEEQVMLPSRLVSWSKQIALGMQYLHSHKIIHRDLKSPNILIS------ 281
            :||| ||.| .||.|:....:.|..|::. :..:...::|.||..::|.|:|..|||::      
  Fly    88 VIME-CPRGQSLQRIVDTLALPLMHRVLI-TLDVVAALRYCHSQNVLHLDVKPTNILVALGTKSS 150

  Fly   282 -----------TNEVVKISDFGTSRE------WNEISTKMSFAGTVAWMAPEVIRNEPCSEKVDI 329
                       .:.:.|:.|||:|.|      |.|.|..   .||:.:|:||.:|::..:|..||
  Fly   151 ITCNSSKIKVKRSYICKLCDFGSSIEMGEFCAWQEPSVA---KGTLRYMSPEALRSDTLTEASDI 212

  Fly   330 WSYGVVLWEMLTCEIPYKDVDSSAII-----------------------------WGVGN----- 360
            :|.|:.:|::....:||..:|.:..|                             |.:.:     
  Fly   213 YSLGITMWQLQARRLPYHTLDCNETIAYQVVKHELRPDNYHQLKILALDSPIDCDWDLAHESTAN 277

  Fly   361 --------------------------------NSLKLLVPSTCPEG-------FKLLVKLCWKSK 386
                                            |.|.|...|..|||       :..|.|.||.|.
  Fly   278 VICRRANTSARRNLSLDPSYTVGRDLKKKRHRNRLALHFDSPAPEGSACSESAYSQLYKSCWVSA 342

  Fly   387 PRNRPSFRQILSHLD 401
            |..|.|..|:...|:
  Fly   343 PELRLSSIQLKHELE 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wndNP_649137.3 STYKc 161..400 CDD:214568 80/337 (24%)
STKc_MAP3K12_13 167..403 CDD:270961 80/335 (24%)
MosNP_610817.1 STKc_Mos 19..298 CDD:270881 64/279 (23%)
S_TKc 26..257 CDD:214567 62/235 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445246
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23257
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.