DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wnd and Takl1

DIOPT Version :9

Sequence 1:NP_649137.3 Gene:wnd / 40143 FlyBaseID:FBgn0036896 Length:977 Species:Drosophila melanogaster
Sequence 2:NP_732554.1 Gene:Takl1 / 318725 FlyBaseID:FBgn0046689 Length:393 Species:Drosophila melanogaster


Alignment Length:412 Identity:118/412 - (28%)
Similarity:202/412 - (49%) Gaps:65/412 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 QIPFESITELE-WLGSGAQGAVFSGRLKNETVAVK-------KVKELKETDIKHLRKLDHENIIK 211
            |:.|..:...| :||:|:.|||.....:|:.:|||       .:|:..|.:|.||.::||||:|:
  Fly     4 QVDFAEVKLSEKFLGAGSGGAVRKATFQNQEIAVKIFDFLEETIKKNAEREITHLSEIDHENVIR 68

  Fly   212 FKGVCTQSPVFCIIMEFCPYGPLQNIL----KEEQVMLPSRLVSWSKQIALGMQYLHS--HKIIH 270
            ..|..:......::||:...|.|.|.|    |.|..:  .:.|.|:.|.|..:.||||  ..|:|
  Fly    69 VIGRASNGKKDYLLMEYLEEGSLHNYLYGDDKWEYTV--EQAVRWALQCAKALAYLHSLDRPIVH 131

  Fly   271 RDLKSPNILI-STNEVVKISDFGTSREWNEISTKMSFAGTVAWMAPEVIRNEPCSEKVDIWSYGV 334
            ||:|..|:|: :.:|.:||.|||.:.:.:...|.|.  ||:.:||||.|::...:.|.|::|:|:
  Fly   132 RDIKPQNMLLYNQHEDLKICDFGLATDMSNNKTDMQ--GTLRYMAPEAIKHLKYTAKCDVYSFGI 194

  Fly   335 VLWEMLTCEIPYKDVDSS----AIIWGVGNNSLKL---LVPSTCPEGFKLLVKLCWKSKPRNRPS 392
            :|||::|.::||..:::.    ||:..:.:.. ||   .|.|.||||.|.|::.|....|..|||
  Fly   195 MLWELMTRQLPYSHLENPNSQYAIMKAISSGE-KLPMEAVRSDCPEGIKQLMECCMDINPEKRPS 258

  Fly   393 FRQILSHLDIAGPELLRKTEKQYFETQKSWKEEVRSHLKEITQNGTNIHKYEQDLIKRRTAE--- 454
            .::|               ||...|..:|..:|  ..:|.:.::...:..|..|....|...   
  Fly   259 MKEI---------------EKFLGEQYESGTDE--DFIKPLDEDTVAVVTYHVDSSGSRIMRVDF 306

  Fly   455 WRH-AQDIRMVY------EDKLQKTNQLFFELSECMS----QLQEKEKEIAERERKLPGSGYKPN 508
            ||| ...|||.:      .::|.||  :..|:::..:    :::..||:......:...:|.:..
  Fly   307 WRHQLPSIRMTFPIVKREAERLGKT--VVREMAKAAADGDREVRRAEKDTERETSRAAHNGERET 369

  Fly   509 RRFG-----NTIRKMQHYRRRL 525
            ||.|     .|:|.::...::|
  Fly   370 RRAGQDVGRETVRAVKKIGKKL 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wndNP_649137.3 STYKc 161..400 CDD:214568 88/260 (34%)
STKc_MAP3K12_13 167..403 CDD:270961 87/256 (34%)
Takl1NP_732554.1 S_TKc 15..262 CDD:214567 86/251 (34%)
STKc_TAK1 17..274 CDD:270960 91/276 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445249
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.