DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wnd and FYN

DIOPT Version :9

Sequence 1:NP_649137.3 Gene:wnd / 40143 FlyBaseID:FBgn0036896 Length:977 Species:Drosophila melanogaster
Sequence 2:NP_001357458.1 Gene:FYN / 2534 HGNCID:4037 Length:537 Species:Homo sapiens


Alignment Length:303 Identity:93/303 - (30%)
Similarity:155/303 - (51%) Gaps:24/303 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 LGCMKPVLSFIGKTGVIEVKSQRSEDWQIPFESITELEWLGSGAQGAVFSGRLKNET-VAVKKVK 191
            |.|...|....|...:.::..:..:.|:||.||:..::.||:|..|.|:.|.....| ||:|.:|
Human   238 LCCRLVVPCHKGMPRLTDLSVKTKDVWEIPRESLQLIKRLGNGQFGEVWMGTWNGNTKVAIKTLK 302

  Fly   192 E--------LKETDIKHLRKLDHENIIKFKGVCTQSPVFCIIMEFCPYGPLQNILKEEQ---VML 245
            .        |:|..|  ::||.|:.:::...|.::.|:: |:.|:...|.|.:.||:.:   :.|
Human   303 PGTMSPESFLEEAQI--MKKLKHDKLVQLYAVVSEEPIY-IVTEYMNKGSLLDFLKDGEGRALKL 364

  Fly   246 PSRLVSWSKQIALGMQYLHSHKIIHRDLKSPNILISTNEVVKISDFGTSR--EWNEISTKMSFAG 308
            |: ||..:.|:|.||.|:.....|||||:|.|||:....:.||:|||.:|  |.||.:.:.....
Human   365 PN-LVDMAAQVAAGMAYIERMNYIHRDLRSANILVGNGLICKIADFGLARLIEDNEYTARQGAKF 428

  Fly   309 TVAWMAPEVIRNEPCSEKVDIWSYGVVLWEMLT-CEIPYKDVDSSAIIWGVGNNSLKLLVPSTCP 372
            .:.|.|||.......:.|.|:||:|::|.|::| ..:||..:::..::..| ....::..|..||
Human   429 PIKWTAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPYPGMNNREVLEQV-ERGYRMPCPQDCP 492

  Fly   373 EGFKLLVKLCWKSKPRNRPSFRQILSHLDIAGPELLRKTEKQY 415
            .....|:..|||..|..||:|..:.|.|:    :....||.||
Human   493 ISLHELMIHCWKKDPEERPTFEYLQSFLE----DYFTATEPQY 531

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wndNP_649137.3 STYKc 161..400 CDD:214568 79/253 (31%)
STKc_MAP3K12_13 167..403 CDD:270961 80/250 (32%)
FYNNP_001357458.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 14..35
SH3_Fyn_Yrk 85..140 CDD:212939
SH2_Src_Fyn_isoform_a_like 145..245 CDD:198281 2/6 (33%)
PTKc_Fyn 261..534 CDD:270655 89/280 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.