DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wnd and Tec

DIOPT Version :10

Sequence 1:NP_649137.3 Gene:wnd / 40143 FlyBaseID:FBgn0036896 Length:977 Species:Drosophila melanogaster
Sequence 2:NP_001106931.1 Gene:Tec / 21682 MGIID:98662 Length:630 Species:Mus musculus


Alignment Length:71 Identity:16/71 - (22%)
Similarity:31/71 - (43%) Gaps:18/71 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LAFENYTSVDVD-------LPF--APKHVIIINTLNPHE-------RLVVH--CRNKGKDLGVHA 70
            :.|..:|:|:|.       |||  ..|...::..|:|:.       |..||  ..:|.||:..:.
Mouse    43 IIFALFTTVEVITDIFLCWLPFYYELKIAFVVWLLSPYTKGSSVLYRKFVHPTLSSKEKDIDEYL 107

  Fly    71 LEPQEQ 76
            .:.:::
Mouse   108 CQAKDK 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wndNP_649137.3 STKc_MAP3K12_13 167..403 CDD:270961
TecNP_001106931.1 PH_Btk 7..148 CDD:269944 16/71 (23%)
SH3_Tec 182..236 CDD:212838
SH2_Tec_Itk 239..346 CDD:198259
PTKc_Tec_Rlk 364..623 CDD:270685
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.