DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ms(3)76Cc and CG14402

DIOPT Version :9

Sequence 1:NP_649136.1 Gene:ms(3)76Cc / 40142 FlyBaseID:FBgn0036895 Length:1174 Species:Drosophila melanogaster
Sequence 2:NP_001286114.1 Gene:CG14402 / 35352 FlyBaseID:FBgn0032894 Length:276 Species:Drosophila melanogaster


Alignment Length:182 Identity:40/182 - (21%)
Similarity:67/182 - (36%) Gaps:57/182 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   365 NWDTNMLDRLISYGVELCRSCWSDCLRDRRPIDLDTFPTQLRMGQFVLELKLIPNVRTGH--WRC 427
            :|:::.||:::|.|    |..:.:.|..|:..|        |.|:..||.........||  |  
  Fly   110 SWNSSALDKIMSNG----RGYYDESLATRQHWD--------RTGELCLECLNTTCFLDGHEFW-- 160

  Fly   428 GVRIIGTDFEAHVSQAL----KELGNVVFQINNQMYAIWLKDGFYYLVDPYRHTIVGTHVAEDKA 488
                  .|.|...:..|    |.||:.:    ::.:...|:.|...|.|   ..:....:.|..:
  Fly   161 ------VDIEKLCTGKLYSRTKSLGSAL----SKFFGQHLQTGILQLRD---QALAFGFIPEFAS 212

  Fly   489 EGAKWATVRMFRDQLTMLSVFH------QLLKESNRQSAYYVHVVRIRNLAE 534
            .||              ..:||      .|.|:.  :||.|  |:|:|.|.:
  Fly   213 GGA--------------FFLFHCQARGRPLFKDC--ESAPY--VLRMRKLQQ 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ms(3)76CcNP_649136.1 AF-4 <631..>1049 CDD:282905
CG14402NP_001286114.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28NDP
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0010003
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.