DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ms(3)76Cc and CG32462

DIOPT Version :9

Sequence 1:NP_649136.1 Gene:ms(3)76Cc / 40142 FlyBaseID:FBgn0036895 Length:1174 Species:Drosophila melanogaster
Sequence 2:NP_730750.1 Gene:CG32462 / 318043 FlyBaseID:FBgn0052462 Length:284 Species:Drosophila melanogaster


Alignment Length:250 Identity:54/250 - (21%)
Similarity:76/250 - (30%) Gaps:100/250 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   339 DDPVRNRSSL-MVAVGSVLASKIDHPANWDTNMLDRLISYG-------VE--------------L 381
            |..||...:| ...|...:||...|...|...:||.::..|       ||              .
  Fly    94 DRKVRGHQTLGCCVVACCVASTFRHLGEWSGKLLDAIVVNGNRYFRASVEQSERWDLHSGVDDAR 158

  Fly   382 CRSCW----SDCLRDRRPID-LDTFPTQLRMGQFVLELKLIPNVRTGHWRCGVRIIGTDFEAHVS 441
            |...|    |...|:...:: |:.|.|:.:.|  :||             |..|....   .|.|
  Fly   159 CNLSWWPSGSPASREMSSLEGLNYFFTRFQFG--LLE-------------CQERRFSF---GHSS 205

  Fly   442 QALKELGNVVFQINNQMYAIWLKDGFYYLVDPYRHTIVGTHVAEDKAEGAKWATVRMFRDQLTML 506
            .                     :||.|:|.|                 .:.||.. :|.|.   :
  Fly   206 S---------------------RDGGYFLFD-----------------CSAWAEA-LFPDD---M 228

  Fly   507 SVFHQLLKESNRQSAYYVHV---VRIRNLAECPE------GYALLPMPDGKDSCE 552
            ..|:.:|.:..:...|.|.|   ||.||:    |      ..|.||....|.|||
  Fly   229 GAFYVMLAKHLQMLLYCVVVTLNVRRRNV----EFRLYNVDVARLPGDARKCSCE 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ms(3)76CcNP_649136.1 AF-4 <631..>1049 CDD:282905
CG32462NP_730750.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28NDP
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0010003
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.