DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ms(3)76Cc and CG12470

DIOPT Version :9

Sequence 1:NP_649136.1 Gene:ms(3)76Cc / 40142 FlyBaseID:FBgn0036895 Length:1174 Species:Drosophila melanogaster
Sequence 2:NP_569838.1 Gene:CG12470 / 30977 FlyBaseID:FBgn0040371 Length:195 Species:Drosophila melanogaster


Alignment Length:166 Identity:65/166 - (39%)
Similarity:90/166 - (54%) Gaps:18/166 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   988 PAASNFVNELDQKEKPPYPKMNVRNAEQSIEHPKNCCCRDA--EEDSMEGIGSRMPVKFPGFSRA 1050
            |||  .|..::....||.|           |.||.....||  |......:....|..:|...|.
  Fly    13 PAA--VVAPIEAPPCPPCP-----------EPPKQMQPLDACPESSGPHDVLRAQPNHYPALLRI 64

  Fly  1051 PHLLAVAGSESGTVESLNRVLSSAFKVANRVLTMTPWGNYVVFRHHPTNRSAATWFYVFDGCTCD 1115
            |..:||.|||:|..:|:.::|.:.|:.|.||..|.|||||||||:|..|...   :::|||||||
  Fly    65 PETMAVVGSENGCYDSICKLLRAGFRCAERVFVMAPWGNYVVFRYHNNNDFI---YFLFDGCTCD 126

  Fly  1116 IDRFRHLDLSTGTAGLIAFRKQSEVVCHIIDSREEK 1151
            ::|||:||||.||||.:.|....:|:.:||.||:.:
  Fly   127 VNRFRYLDLSCGTAGFLFFDNMHDVISYIIQSRKTR 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ms(3)76CcNP_649136.1 AF-4 <631..>1049 CDD:282905 15/62 (24%)
CG12470NP_569838.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0010003
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.