DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment asf1 and SGA2

DIOPT Version :9

Sequence 1:NP_001189131.1 Gene:asf1 / 40141 FlyBaseID:FBgn0029094 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_176846.1 Gene:SGA2 / 842992 AraportID:AT1G66740 Length:196 Species:Arabidopsis thaliana


Alignment Length:203 Identity:104/203 - (51%)
Similarity:137/203 - (67%) Gaps:24/203 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAKVHITNVVVLDNPSSFFNPFQFELTFECIEELKEDLEWKMIYVGSAESEEHDQVLDTIYVGPV 65
            |:.:.||||.||.||:.|.:|||||:::||:..||:|||||:|||||||.|.:||:|:::.||||
plant     1 MSAIKITNVAVLHNPAPFVSPFQFEISYECLNSLKDDLEWKLIYVGSAEDETYDQLLESVLVGPV 65

  Fly    66 PEGRHIFVFQADPPDVSKIPEPDAVGVTIVLLTCSYRGQEFVRVGYYVNNDYADPEMRENPPTKP 130
            ..|.:.|||||||||.|||.|.|.:|||::||||||.||||:||||||||||.|.:::|.||||.
plant    66 NVGNYRFVFQADPPDPSKIQEEDIIGVTVLLLTCSYMGQEFLRVGYYVNNDYEDEQLKEEPPTKV 130

  Fly   131 LFEKLTRNILASKPRVTRFKINWDYGHINGNGNGVENGHQDEMATDGPSTSEAASAVIHPEDDNS 195
            |.:|:.||||:.|||||:|.|::               |.:|         |..:|...|.:.:.
plant   131 LIDKVQRNILSDKPRVTKFPIDF---------------HPEE---------EQTAATAAPPEQSD 171

  Fly   196 LAMPMENG 203
            ...|..||
plant   172 EQQPNVNG 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
asf1NP_001189131.1 ASF1_hist_chap 1..154 CDD:282572 96/152 (63%)
SGA2NP_176846.1 ASF1_hist_chap 1..154 CDD:398417 96/167 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 213 1.000 Domainoid score I773
eggNOG 1 0.900 - - E1_COG5137
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H8528
Inparanoid 1 1.050 215 1.000 Inparanoid score I1228
OMA 1 1.010 - - QHG54218
OrthoDB 1 1.010 - - D1334998at2759
OrthoFinder 1 1.000 - - FOG0001913
OrthoInspector 1 1.000 - - otm2908
orthoMCL 1 0.900 - - OOG6_101293
Panther 1 1.100 - - O PTHR12040
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1264
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.