DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment asf1 and ASF1B

DIOPT Version :9

Sequence 1:NP_001189131.1 Gene:asf1 / 40141 FlyBaseID:FBgn0029094 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_198627.1 Gene:ASF1B / 833791 AraportID:AT5G38110 Length:218 Species:Arabidopsis thaliana


Alignment Length:204 Identity:108/204 - (52%)
Similarity:140/204 - (68%) Gaps:18/204 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAKVHITNVVVLDNPSSFFNPFQFELTFECIEELKEDLEWKMIYVGSAESEEHDQVLDTIYVGPV 65
            |:.::||||.|||||:.|.||||||:::||:..||:|||||:|||||||.|.:||||:::.||||
plant     1 MSSINITNVTVLDNPAPFVNPFQFEISYECLTSLKDDLEWKLIYVGSAEDETYDQVLESVLVGPV 65

  Fly    66 PEGRHIFVFQADPPDVSKIPEPDAVGVTIVLLTCSYRGQEFVRVGYYVNNDYADPEMRENPPTKP 130
            ..|.:.||.|||.||..||.|.|.:|||::||||||..|||:||||||||||.|.::||.||||.
plant    66 NVGNYRFVLQADSPDPLKIREEDIIGVTVLLLTCSYMDQEFIRVGYYVNNDYDDEQLREEPPTKV 130

  Fly   131 LFEKLTRNILASKPRVTRFKINWDYGHINGNGNGVENGHQDEMAT--DGPSTSEA-ASAVIHPED 192
            |.:|:.||||..|||||:|.||:               |.:...|  |||:.:|. |.:|::.|.
plant   131 LIDKVQRNILTDKPRVTKFPINF---------------HPENEQTLGDGPAPTEPFADSVVNGEA 180

  Fly   193 DNSLAMPME 201
            ...|..|.:
plant   181 PVFLEQPQK 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
asf1NP_001189131.1 ASF1_hist_chap 1..154 CDD:282572 97/152 (64%)
ASF1BNP_198627.1 ASF1_hist_chap 1..154 CDD:398417 97/167 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 213 1.000 Domainoid score I773
eggNOG 1 0.900 - - E1_COG5137
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H8528
Inparanoid 1 1.050 215 1.000 Inparanoid score I1228
OMA 1 1.010 - - QHG54218
OrthoDB 1 1.010 - - D1334998at2759
OrthoFinder 1 1.000 - - FOG0001913
OrthoInspector 1 1.000 - - otm2908
orthoMCL 1 0.900 - - OOG6_101293
Panther 1 1.100 - - O PTHR12040
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1264
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.