DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment asf1 and Asf1b

DIOPT Version :9

Sequence 1:NP_001189131.1 Gene:asf1 / 40141 FlyBaseID:FBgn0029094 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_077146.1 Gene:Asf1b / 66929 MGIID:1914179 Length:202 Species:Mus musculus


Alignment Length:230 Identity:127/230 - (55%)
Similarity:158/230 - (68%) Gaps:41/230 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAKVHITNVVVLDNPSSFFNPFQFELTFECIEELKEDLEWKMIYVGSAESEEHDQVLDTIYVGPV 65
            ||||.:.||.||:|||.|.:||:||::|||.|.|.:|||||:||||||||||.||:||::.||||
Mouse     1 MAKVSVLNVAVLENPSPFHSPFRFEISFECSEALSDDLEWKIIYVGSAESEEFDQILDSVLVGPV 65

  Fly    66 PEGRHIFVFQADPPDVSKIPEPDAVGVTIVLLTCSYRGQEFVRVGYYVNNDYADPEMRENPPTKP 130
            |.|||:||||||.|:.|.|||.||||||:||:||:|.||||:||||||||:|.|||:|||||.||
Mouse    66 PAGRHMFVFQADAPNPSLIPETDAVGVTVVLITCTYHGQEFIRVGYYVNNEYPDPELRENPPPKP 130

  Fly   131 LFEKLTRNILASKPRVTRFKINWDYGHINGNGNGVENGHQDEMATDGPSTSEAASAVIHPEDDN- 194
            .|.:|.||||||.||||||.||||                     :.|.:.||    |..:|.| 
Mouse   131 DFSQLQRNILASNPRVTRFHINWD---------------------NNPDSLEA----IENQDPNV 170

  Fly   195 --SLAM---PMEN-GIKA-----LNENSNSLAMEC 218
              ||::   |::: |:.:     |.|||    |:|
Mouse   171 DFSLSLSCTPVKSLGLPSCIPGLLPENS----MDC 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
asf1NP_001189131.1 ASF1_hist_chap 1..154 CDD:282572 109/152 (72%)
Asf1bNP_077146.1 Interaction with histone H3 and CHAF1B. /evidence=ECO:0000250 1..156 111/175 (63%)
ASF1_hist_chap 1..154 CDD:282572 109/152 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835908
Domainoid 1 1.000 255 1.000 Domainoid score I2032
eggNOG 1 0.900 - - E1_COG5137
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 255 1.000 Inparanoid score I3160
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54218
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001913
OrthoInspector 1 1.000 - - otm44071
orthoMCL 1 0.900 - - OOG6_101293
Panther 1 1.100 - - O PTHR12040
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R94
SonicParanoid 1 1.000 - - X1264
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.790

Return to query results.
Submit another query.